KEGG   Histophilus somni 129PT: HS_0410Help
Entry
HS_0410           CDS       T00386                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
hso  Histophilus somni 129PT
Pathway
hso00240  Pyrimidine metabolism
hso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hso00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    HS_0410 (tdk)
Enzymes [BR:hso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     HS_0410 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_14 RNase_E_G
Motif
Other DBs
NCBI-ProteinID: ABI24688
UniProt: Q0I2E3
LinkDB All DBs
Position
complement(436082..436669)
Genome map
AA seq 195 aa AA seqDB search
MAKLYFYYSTMNAGKSTTLLQSDYNYRERNMNTLVYTAAIDDRFGKGKVSSRIGIHRQAN
LFHKDTDLFTEIALHIKQQKLHCILIDEAQFLTKAQVYQLSNVVDELNIPVLCYGLRTDF
QAELFEGSKYLLAWADQLEELKTICYCGRKANFVLRLNEQGKAVKDGEQIQIGGNDSYMS
VCRKHYKEILYSSNE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactatatttttattattccacgatgaatgcggggaaatctacaaccttatta
caatcggattataactatcgtgaacgtaacatgaatacgttagtttatacagctgccatc
gacgatcgttttggtaaaggtaaagtgagttcacgtattggcattcatagacaagcgaat
ttatttcataaagacactgatctttttactgaaatagcactgcatattaagcagcaaaaa
ttacattgtattttaattgatgaagctcagtttttaacgaaagcacaagtctatcaacta
agcaatgtggtagatgaactcaatattccggtattatgctatggtctgcgtacagatttc
caagcagaattattcgaaggaagcaaatatctgttggcttgggcagatcaacttgaagaa
ttgaaaactatttgttactgcggtcgtaaagctaattttgttttacgcttaaatgaacaa
ggtaaagcagtcaaagacggtgagcaaattcaaattggcggaaatgatagttatatgtcg
gtatgccgtaaacattataaagaaatactttattcttctaatgaataa

DBGET integrated database retrieval system