KEGG   Histophilus somni 129PT: HS_1141
Entry
HS_1141           CDS       T00386                                 

Gene name
gatD
Definition
(GenBank) galactitol 1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
hso  Histophilus somni 129PT
Pathway
hso00052  Galactose metabolism
hso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    HS_1141 (gatD)
Enzymes [BR:hso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     HS_1141 (gatD)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C TrkA_N Pyr_redox 2-Hacid_dh_C Pyr_redox_2 Shikimate_DH ADH_zinc_N_2 UDPG_MGDP_dh_N ELFV_dehydrog ThiF HI0933_like 3HCDH_N Pyr_redox_3 NAD_binding_7 FAD_binding_3 ssDNA_TraI_N
Other DBs
NCBI-ProteinID: ABI25416
UniProt: Q0I405
LinkDB
Position
complement(1279962..1281005)
AA seq 347 aa
MKAIVLESNRNMAICDIPKPLVEDPDDVLVKVHYSGLCGSDIPRIFHHGTHFYPIVLGHE
FSATVEEVGSDVTELDKGDLVSCAPLQPCFKCDECNRGFYSLCKNYNFIGSRRFGANSEY
LCVKKSNLVKLPQGSDTLQASFIEPITVGLHAIHLAGGCKGKNVVIVGAGTIGLLAAQST
KALGANSVSVIDINQEKLVLAKTLGADYVFNSMDLKADEILACLDGNRFDQLILETAGVP
KTVELSIQIAGPRAQVVLVGTLHHDLNLDQKEFGLILRKELIIFGSWMNYSKPWPGVEWR
EAVNLIAENKICFEPLISSINTIEDYVEEVKSLDGKPMNGKLVLKFD
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaagctattgttttagaatctaaccgtaatatggctatttgtgatattcctaagcct
ttagtcgaagaccctgatgatgtgttggtaaaagtgcattactccggactatgtggttcc
gatattccaaggatttttcatcatggtactcacttctatcctattgttttaggtcacgaa
tttagtgctacagtagaagaagtaggctcagatgtaacggaattggataagggagattta
gttagctgtgctcctctccagccctgttttaaatgtgatgaatgtaatagagggttttac
tctttatgtaaaaactacaattttatcggttcacgccgcttcggtgctaactcagagtat
ctttgtgtgaaaaagagtaatttggtgaagttacctcaaggaagtgacacattgcaagca
tcttttattgagcctatcactgttggattgcatgctattcatcttgcaggaggctgtaaa
ggtaaaaatgtggttatagttggagcaggtactatcgggttactggcagctcaatctaca
aaagcattaggggcaaattcagttagtgtgattgacatcaaccaagaaaaattggtgttg
gcaaaaacattaggtgcagattacgtatttaattcaatggatttgaaagctgacgaaatt
ctagcctgtttagatggtaatcgatttgatcaactaattttagaaacagcgggggtaccg
aaaactgttgaactttccattcaaattgctggacctagagctcaagtcgtattagttgga
acactacaccacgacctaaatctcgatcaaaaagaatttggactgattttacgcaaagaa
cttatcatttttggttcttggatgaattactccaaaccttggccgggagtcgaatggcga
gaagcagttaatcttattgcagaaaataaaatctgctttgaaccgcttatctcgtcgatt
aacactattgaagattatgtggaagaagtgaaatccttagacggtaaaccgatgaatgga
aaattggtattaaaattcgactaa

DBGET integrated database retrieval system