KEGG   Histophilus somni 129PT: HS_1776
Entry
HS_1776           CDS       T00386                                 

Definition
(GenBank) conserved hypothetical protein
Organism
hso  Histophilus somni 129PT
SSDB
Motif
Pfam: DUF1525
Other DBs
NCBI-ProteinID: ABI26044
UniProt: Q0I5P3
LinkDB
Position
complement(1996261..1996698)
AA seq 145 aa
MIKRTLLFCLGISISAWAELPSEVNITVFSTQAYPIQNAQLAHRLYHLDSVEQWEEQLSQ
TLSANPAQAENQAKAFFQHPDSQTKIRELQQAYQGVILGWQMGIRKVPAVLFDSPQLGQA
VVYGVTDVQQAITFWEQWISQKGEK
NT seq 438 nt   +upstreamnt  +downstreamnt
atgataaagcgaacgctccttttttgtttgggcataagtatatctgcttgggctgagctt
ccaagcgaagtcaatattactgttttcagcacgcaagcctaccctattcaaaatgctcaa
ttagctcaccgcctttaccatctcgacagtgtagaacaatgggaagaacagcttagccaa
actttaagtgccaatccggcacaagcggaaaatcaagccaaagcgttctttcagcatccc
gatagccaaacaaaaattcgcgaattacaacaggcttatcaaggtgtaattttgggttgg
caaatgggcattcgcaaagtacccgctgtgttatttgacagtccacaactcggtcaagcg
gtggtttatggcgtgactgatgtgcaacaggcaataacattttgggaacaatggatatct
caaaaaggggagaaataa

DBGET integrated database retrieval system