KEGG   Halomonas sulfidaeris: HSBAA_42940Help
Entry
HSBAA_42940       CDS       T06264                                 

Definition
(GenBank) hypothetical protein
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hsr  Halomonas sulfidaeris
Brite
KEGG Orthology (KO) [BR:hsr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HSBAA_42940
Enzymes [BR:hsr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HSBAA_42940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA K_oxygenase FAD_binding_2 HI0933_like FMO-like FAD_oxidored DUF3467
Motif
Other DBs
NCBI-ProteinID: BBI62988
UniProt: A0A455UFF5
LinkDB All DBs
Position
2696666..2697565
Genome map
AA seq 299 aa AA seqDB search
MIGGGPAGAAAAIYSARKGINTGIAAERFGGQVADTMGIENFISVSHTEGPKLVSALEEH
VKDYEVDVMNLQLATTFKAAEAEGGLHEVTFESGAKLKSKTLVLATGARWREMNVPGEQQ
YRNKGVAYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVGHVTLVEFMGEMRADAVL
QKKLKSLPNVDIILNAQTTEVTGDGSRVNGLNYKDRTTDESKSIALEGIFVQIGLVPNTE
WLKGSPIEMTPRGEIIVDAHGMTSVPGVFAAGDVTTVPYKQIIIAMGKVLKHRLALLIT
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgattggcggaggccctgcaggcgctgcggcggccatttactcggcgcgtaaaggcatc
aatacgggtattgccgctgagcggttcggtggtcaggtggccgacaccatggggattgaa
aacttcatttctgtttcccatacagaaggccctaagctggtcagtgcacttgaagagcac
gtaaaagactacgaagtcgacgtcatgaacctgcagcttgcgactacatttaaagcggcc
gaagccgaaggcggcctgcatgaagtcacgtttgaatcaggcgctaaactcaagagtaaa
acgctggttttggcgacaggcgcccgttggcgtgaaatgaacgttccaggtgaacagcag
taccgcaacaaaggcgtcgcttactgcccccactgcgatggcccgctgttcaaaggtaag
cgtgtagcggtcattggtggtggtaactcgggcgttgaggcagctattgacctggcgggc
attgtcggccacgtcacgttggttgaatttatgggcgaaatgcgcgctgacgccgtgctg
cagaagaagctcaagagcttgcccaatgtcgatattattctcaacgcacaaacgaccgaa
gttactggcgatggcagccgtgttaatggcttgaactataaagaccgtacaaccgatgaa
agcaaatccatcgcgttggaaggtattttcgttcagattggtttagtacctaacaccgag
tggctgaaaggctcaccgattgaaatgacgccccgcggtgaaatcattgtcgatgctcat
ggcatgacgtccgtgcccggtgtgtttgccgcaggcgatgtcacgaccgtgccttacaag
cagatcattatcgccatggggaaggtgctaaagcatcgcttggcgcttttgattacttga

DBGET integrated database retrieval system