KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105180687
Entry
105180687         CDS       T03918                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen isoform X2
  KO
K16679  wengen
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst04013  MAPK signaling pathway - fly
hst04214  Apoptosis - fly
hst04215  Apoptosis - multiple species
hst04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:hst00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    105180687
   04391 Hippo signaling pathway - fly
    105180687
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    105180687
   04215 Apoptosis - multiple species
    105180687
SSDB
Motif
Pfam: TNFR_c6 CD225 Trp_oprn_chp HCO3_cotransp
Other DBs
NCBI-GeneID: 105180687
NCBI-ProteinID: XP_011135207
LinkDB
Position
Unknown
AA seq 257 aa
MPRESCRGLLLTLVSVFVGLYESAGATSSTQYPICKPGLEFWSTDRASCWPCTRCTPEFT
LSPCVLHNDAICGPLSALELDWSFLSTRKRPEAGQRHLETVTSKVLWRLSEPTEKLQKQS
HEEVSDPVGLSREDNGVLDDEEPVSASQQSKPQAAHDPRERRKSTSVDNLPWDWQTGALV
LAVCTCIVFFLVAGCSALVYARQWRRMKKNFEPAGLEEISARLNLMVKAELAELVSGAPM
NPGDPETRCQYLEKLLG
NT seq 774 nt   +upstreamnt  +downstreamnt
atgccgagggaatcctgtcgggggttgctgttgaccctggtgtcggtattcgtcggtctg
tatgagtctgccggcgcgacatccagcacgcagtatccgatctgcaaacccggcttggaa
ttttggtccacggatcgcgcctcctgctggccttgcacccgatgtacgcccgagttcacg
ctaagtccatgcgtgttacacaacgacgcgatctgcggtccgctgtcggctctggagctt
gattggtccttcttgtcgaccaggaaaaggccagaggctgggcaacgtcaccttgagacc
gttacctcgaaggtactctggcggttgtccgaaccgacggagaagttgcagaagcaatct
cacgaagaagtcagtgatcctgttggccttagtcgagaggacaacggtgtcctggacgac
gaagagccagtctctgcttcgcagcagtcgaagccacaggcagcacacgatcctcgggag
agaagaaaatcaactagcgtggacaatctcccgtgggactggcagactggcgccctggtt
cttgcagtgtgcacctgtatagtatttttcttggtagcaggatgctcggctcttgtctat
gcgagacaatggaggcgtatgaaaaaaaattttgaaccagcgggtctcgaagaaatctcg
gccaggttaaatttgatggtgaaagcagagttagccgaactggtctcaggagctccgatg
aatccaggtgatcccgagactagatgtcaatatctcgagaaacttttaggataa

DBGET integrated database retrieval system