KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105181042Help
Entry
105181042         CDS       T03918                                 

Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret isoform X2
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Brite
KEGG Orthology (KO) [BR:hst00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hst01001]
    105181042
Enzymes [BR:hst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     105181042
Protein kinases [BR:hst01001]
 Receptor tyrosine kinases (RTK)
  RET family
   105181042
Cytokine receptors [BR:hst04050]
 Receptor tyrosine kinase
  RTK class XIV (RET receptor family)
   105181042
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 105181042
NCBI-ProteinID: XP_011135865
LinkDB All DBs
Position
Unknown
AA seq 1220 aa AA seqDB search
MRTAGLPLATFLLSWLIAIRTLALGLYFPQSNLTLRLPYLAQHGAAVLPRVKLVDLRTLR
DDSTTPKNVEYRLRTDPQNFAIQQENSSNIVLQSLPVNGTGSIIVEASETSFDKAVLDIL
VQPVAVTTKTIDCTDFLQDMCFWNTSIYKIYENQPVTMIGTFGPEAYGYVCPEFNVTRYE
LLNGTKYFHAVDGMLFANASLDRDILDTSVPHMTSANASLDQNNLSGPGPLVMVEVNCVI
WETSGRQYTQTKVIAIDILDEDDNPPSMQGNNSIVKELEDFSTGATLINTLILSDADAMT
TNRYNVLLLGDTHNAFRISHQTLPIEHSKHHPNKAPFTVIVVSIDARKTLLPKSPYNVTI
QAIDESLLPRYGPNTANISVSFTGPVHRISTTKKSSSSAPTTLEPVLFPTSVMIARLSPR
YFRVTEQAVNLWSSRTFVLNGSSAFDVTQRSGIVYVSNETLLRSEPATILLKLKWGEEKR
AEWTLQVNLIDVPPSKGNNTCRLTQEMHSCANARSRDKCVQSCGIASGALSNGSFAGQCV
WRSNDRNNGTSQMSESYSTCSPNLAYCPDNKCDELERSDPRICPQDCIVESDVHFAHIHP
NGRGIKSGLGTCACSDLPKCTCGLDAFRHVIVSNAKEKRLYAGKLRDRKNEVVASGTRKA
SSNPCGPTCMMGVIGASLFVLIVIVGSFVMWRYRRAAKGARRECKHRVDDAANGIGILPS
DYIDRGDGLLIGLDTFTTANRHLLLPKTCPPDPKWEFPRSRLTIEQVLGEGEFGRVLRAK
AIDIGGWSGPTTVAVKTLKEDACASELADLLSEYQLLKEAQHPNVIRLLGACTTPGAPVY
LIIEFAEFGSLRNYLRRSRNLKTEGRTGCSTSLLSASSGNNTGEESRCADNALTYTITPH
DILSFAWQISKGMAYLADIKLVHRDLAARNVLLATGKVCKISDFGLTRDVYEDDAYLKRS
KGRVPVKWMAPESLADHVYTSKSDVWSFGVLLWELVTLGASPYPGVDVHNLYNLLKSGYR
MERPVNCSQQLYKLMMSCWHLEPGMRPSFKELTCHWERMLEDGIEYLDLNPRTVHNQAYF
ESLHSLDKMDDSDDNETVSNLKTDTVNYLGRMSSEPVTKCDKVDKLQALWQMSIASFPEE
PVKSSYVNDRPASLNANHYESPIKLRNTSVTSNSENDLRICSQERPQSYIDMQGKKSTET
EDLLMFGSMDDDRSDNNVTN
NT seq 3663 nt NT seq  +upstreamnt  +downstreamnt
atgcggaccgccggactgccgttggcgactttcctgctatcctggctgatcgcgataagg
acactggccttgggtctctacttcccgcaatcgaatctgacgctgaggctaccgtacttg
gcgcaacacggcgcggcagtcttgccgcgggtgaagttggtcgacctgaggactctccgc
gacgactccacgacgccgaaaaacgtagagtatcgactcagaacagacccgcagaacttc
gcgatccagcaggagaacagtagcaatatcgtgctgcagagccttccggtgaatggcacc
ggctctatcatcgtcgaggcgagcgagacgagtttcgacaaggcggtgctcgatatatta
gtgcaaccagtggcagtaacgacgaaaacgatcgattgtacggactttttgcaggacatg
tgcttttggaacacgtccatatacaagatttacgagaatcaaccggtcaccatgattggc
acgttcggtccggaggcgtacggctacgtgtgccccgaattcaacgtcaccagatatgag
ttattgaacggaacgaagtactttcacgccgtcgacggtatgctgttcgcgaacgcgtcc
ttggaccgggacatcctggacacatccgtgcctcacatgacgtccgcgaacgcgtccttg
gaccagaacaatctgagcgggcccggacctctcgtgatggtggaggtgaactgtgtcatc
tgggagacgagcggccgacagtacacgcagacgaaagtcatcgccatcgacatcctggat
gaggacgacaatcctccttccatgcagggcaataattccatcgtaaaagaactcgaagac
ttcagcacgggcgccacgttgatcaacactttgatcctgtcggacgccgacgcgatgact
accaaccggtacaacgtcctgctgctcggggacacccacaacgccttcaggatcagtcac
cagacgctgccgattgagcattccaagcaccatccgaacaaggcacctttcaccgttatt
gtcgtcagtatcgacgccaggaagacgttgctgccgaaatcgccgtacaacgtgaccata
caggccatcgacgagtcgcttctcccgcggtacggaccgaatacggcgaacatcagtgta
tcgttcacgggcccggtgcaccgaatttccacgaccaagaagtcatcatcatcagccccg
acgacgctggagccggtcttgttccccacgagtgtgatgatcgcgcggctctcgccgagg
tactttcgcgtgacggaacaggcggtgaacctgtggtcctcgcgaacttttgtcctaaac
gggtcaagcgccttcgacgtcacccagcgaagcggcatcgtctacgtatcgaacgagacg
ttgttgcgctctgagcccgccaccattctactgaaattaaaatggggcgaggagaagcgc
gccgagtggacgctgcaagtgaatctgatcgacgtgccgccgtcgaagggcaacaacacc
tgcagactgactcaagagatgcactcgtgcgcgaatgcaagatcgcgcgacaaatgtgtg
cagtcctgcggaatcgccagtggagcactcagcaatggcagtttcgccggtcaatgtgtc
tggagaagtaacgaccgcaacaacggcacttctcagatgtcggagagctattccacctgc
tcgccgaacctcgcttactgccccgacaacaagtgcgacgaactggagcgcagcgatccg
cgcatatgcccgcaggattgcatcgttgaatccgacgtgcacttcgcgcacatccacccg
aacggccgcggcataaaaagcggcctgggtacctgcgcctgcagcgatctacccaagtgc
acctgcggactcgatgcctttcgccacgtgatcgtctcaaacgccaaagagaagcgactg
tacgccggaaaattacgcgaccgcaagaacgaggtcgtcgcgtcgggcacgcgcaaagcg
tccagcaatccgtgcggtcccacgtgtatgatgggtgtcatcggggccagtctgttcgtg
ttgatcgtcatcgtcggctcgttcgtcatgtggcggtacaggagggcggcgaagggcgca
cgacgggaatgcaaacacagggtggacgatgcggcgaatggtattggtattctaccgtcc
gactacattgatcgcggtgacggcctcctgatcggtctagacaccttcacgacggcgaat
cgtcatctgttgctgcccaagacgtgtccgccggacccgaagtgggagttccctcggtcg
cggctgacgatcgagcaagtgctgggcgagggtgagttcgggcgcgtcctgcgtgccaaa
gccatcgacatcggcggatggtccgggcccacgaccgtggcggtgaagaccctgaaggag
gacgcgtgcgcctccgagttggccgatctgctgtccgagtatcagttgctgaaagaggcg
cagcatccgaacgtgatccggctgctgggagcttgcacgacgccgggcgcgcctgtctac
ctcatcatcgagttcgccgaattcggttccttacgcaactatctgaggcgcagccgtaac
ttgaagacggaaggaagaaccggctgctcgacgtctctgctttccgcttcgtcgggcaac
aacaccggcgaggagtcgcgatgcgccgataacgcgttgacctacactataacgccgcac
gatattctctcgttcgcttggcaaataagcaaagggatggcgtatctcgccgacattaag
ttggtgcatcgggacctcgcggcgaggaatgttttgctcgccactggaaaggtctgcaag
atctcggacttcggcctgactcgcgacgtctacgaggacgacgcgtacctgaagcgcagc
aaagggcgagtgcccgtgaaatggatggcgcccgagtccctggccgaccatgtgtacacc
agcaaatcggatgtttggagcttcggcgtgctcctgtgggagttggtcacgttgggagcc
tcgccgtatcccggagtggacgtacataatctctacaatctcctcaagtccggctatcgc
atggagaggccggtcaattgttcgcagcaattatacaagctgatgatgtcctgttggcat
ctggagcccggcatgcggccgtctttcaaggaactgacctgccattgggaacgcatgctg
gaggatggtatcgagtatctcgatcttaatccgcgaaccgtccacaatcaggcctacttt
gagtccttgcattccttggacaaaatggacgattccgatgacaacgagactgtcagcaac
ctgaagacggacaccgtcaattacctcggcagaatgtcctccgagccggtcaccaagtgc
gacaaggtggacaaattgcaggcgctctggcagatgtccatagcgtccttccccgaggag
cccgtcaaatcctcctacgtgaacgatcgacccgcaagcctcaacgctaatcattacgag
agtcccattaaactgagaaatactagtgtgaccagcaacagtgagaacgacctgcgaata
tgcagtcaggaacgtcctcagtcctatattgacatgcaagggaagaaatcgactgagacg
gaggacctcttgatgttcggcagtatggacgacgacaggagcgacaataacgtgacaaat
tga

DBGET integrated database retrieval system