KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105181904Help
Entry
105181904         CDS       T03918                                 

Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00052  Galactose metabolism
hst00500  Starch and sucrose metabolism
hst01100  Metabolic pathways
hst04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105181904
   00500 Starch and sucrose metabolism
    105181904
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105181904
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hst04147]
    105181904
Enzymes [BR:hst01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105181904
Exosome [BR:hst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105181904
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 105181904
NCBI-ProteinID: XP_011137287
LinkDB All DBs
Position
Unknown
AA seq 1002 aa AA seqDB search
MTKIDNSLNMEISETYKSLANQNHIQERLNSFNKRTYMKCRIVWFSLGCSIMVVSLLMLL
NTLIVTTQNYESIEMQLMIDVNNDTIEETKYQHISVDTSDTYIDQQDYNYIMYKKISLKE
INNLYEKNTAPDQCSNIPEVLRFDCYPEDGASQLSCTNRGCCWKPLEKGTVSRILNVPYC
YYPQNWDLYKYINYSRDDSDFSGFLKQERKSAYKNDVPLAKIEAINIDSSTLRVKIYDPL
NARYEPPWPVKLDTKSVLSEIANKMYHFKNDEVRPGFKIDRISDGTTLFNSIGIGGFIFA
DQFLQISSLLPTSNIYGIGDHRSSLKLDTKWQSFTLFNKDQPPAENANLYGSHPFYIVIE
DSGMAHGVLFLNSNAMDVILQPTPAITFRTIGGIFDIYFFLGPTAADVVRQYSEIVGKPF
MPPYWSLGFHLCRYGYGNLEKTKTVWNRTRAAGIPFDTQWNDLDYMDKNNDFTYDKNTFK
DLPKFVEELHSIGMHYIPLIDAGISAFDNNGSYLPYVEGIKQDIFVKDGVSNEPFVGKVW
NLVSTVWPDFTNPKTTNYYAKMMSNMHNSFAYDGAWIDMNEPSNFYNGHKNGCLHTNLDY
PEYVPNVVGGLLATKTLCMNAKHHLGSHYNLHNTYGISHAIATNYALKEIRKKRPFVISR
SSWVGHGYYAGQWTGDIYSSWHDMKMSIPAILSQNFYQIPMVGADICGFDGNTTVALCNR
WVQLGAFYPFSRNHNSDNTIEQDPVAMGDLVVQSSRNALRIRYRLLPYLYTLFFRAHKFG
DTVVRPLFFEFTYDTQTYDIDTQFLWGRSLMINPVLEENQSNLTVYVPRGLWYDYHTLVS
FFSIGKHFTLPVLLTEIPLLIRGGSILPAQKPGATTTESRKNNFELLVALNEVGYAEGEL
YWDDGDSIDSVEKNEYLWLMFNAFSNMTKLVSTRMDIGTFNDEVILGRVDILGIHYSVSE
VYLNDSPVKFAYNINTKNLSIFGIQVDMKRPFVFTWTYMPFF
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgataatagcttaaatatggaaataagtgaaacttacaagtcattggcg
aaccaaaatcatattcaagaaagattgaatagcttcaataaacgtacttatatgaaatgc
agaatagtatggttcagccttggttgttccattatggttgtttccttattgatgctctta
aatacattgatagtcactactcagaattatgaaagcatagaaatgcagctaatgattgat
gtgaataatgatactattgaagaaacaaaatatcagcatatatctgtggatacttcagat
acatatattgatcagcaagattataattatataatgtataaaaagataagcctaaaagaa
ataaacaacttatatgagaaaaatacagcccctgatcagtgcagcaatattcctgaagta
ctacgttttgattgctatccagaggatggagcatcgcaactttcttgcacaaatagagga
tgttgttggaaacctcttgaaaaagggacagtatcacgtatattgaatgtcccatattgt
tactatccacaaaattgggacttgtataaatatattaattatagtcgagatgatagtgat
ttttcaggctttcttaaacaagaaagaaaatctgcatataagaatgatgtacctcttgcg
aaaatagaagctataaatatagatagttcaactttacgtgtgaagatatatgatccttta
aacgcgcgatatgaaccaccatggccagttaagttagatacaaaatctgtcttatctgag
attgccaacaaaatgtatcattttaaaaatgatgaagtgagacctggttttaaaattgat
agaattagtgatggtacaacattattcaattctattggcatcggaggtttcatctttgcc
gatcagtttttacaaataagttcgttacttcctacaagcaacatctatggcattggtgat
cataggtcaagcttaaagttagatacgaaatggcaatcgtttactttattcaataaagat
caaccaccagcagaaaatgcaaatttgtacggatctcatccgttttatattgttattgag
gattctggtatggctcatggagttttatttttaaatagtaatgccatggatgtaatattg
cagccaacaccagctataacgtttagaacaatcggtggtatttttgatatttatttcttt
ttggggcctaccgcagcagacgttgtgagacaatattctgaaatcgtaggcaaaccgttt
atgccaccttattggtcgcttggttttcatttatgcagatatggatatggaaacttagag
aaaaccaaaacagtatggaacagaacgagagctgctggaattccatttgacactcagtgg
aacgatttggattatatggataaaaacaacgatttcacatatgacaagaatacgttcaag
gacttgccaaaattcgtagaagagcttcattcgattggaatgcattatatccctttaatc
gatgccggtatatccgctttcgataataacggttcttatcttccatatgtcgagggaata
aaacaggatatattcgtaaaagatggtgtttcgaacgagcctttcgtcggcaaagtctgg
aatcttgtttctacggtgtggcccgacttcacaaacccgaaaacaactaactactatgca
aaaatgatgagcaatatgcacaatagttttgcgtatgatggcgcatggattgatatgaac
gaaccatctaacttctacaacggtcacaaaaatggctgtttacacactaatctggattat
cctgaatacgtacccaacgtcgtcggtggtttgctcgctacgaagactctgtgtatgaat
gcaaaacatcacttaggctctcattacaatcttcataatacttacgggataagtcacgca
attgctacgaattacgctctcaaagaaatcaggaagaaaagaccatttgtaatatcgcgc
tcgtcatgggtaggacacggttattacgccggccaatggacgggcgacatttattcctca
tggcacgatatgaagatgagcattccagcaatcttgtcgcaaaatttctatcaaatcccc
atggtaggcgcagatatttgtggattcgacggcaacacgaccgttgcgttatgcaaccgc
tgggtgcaacttggcgccttctatccgttctctcgaaatcacaattccgataatacgatc
gaacaggatccggtcgccatgggcgacttggttgtacaatcctcgaggaatgctctcagg
atacgttaccggcttttaccgtatttgtacacgttattcttcagagcgcacaagttcggc
gacacggtggtgcgtccgctcttctttgagtttacctacgatacgcaaacttacgatatt
gacacacagttcctctggggaaggtcacttatgatcaatcccgtcctcgaagagaaccaa
agtaacttgactgtttacgtaccacgcggactgtggtacgattatcacactcttgtatct
ttcttctccattgggaagcatttcacgttgcctgtgctgcttactgaaataccattattg
attcgcggtggttcgatacttccagcgcagaaaccaggcgcgacgacgaccgagagcagg
aagaataattttgaattattagtggctttgaatgaagtcggttatgccgaaggagaactc
tactgggacgacggtgatagcatagattctgtagaaaagaacgaatatctgtggttgatg
ttcaatgcattctcgaacatgacgaaattagtgagcacgagaatggatatcggcactttt
aacgacgaagtaatacttggcagagttgatattttgggcatacattattcagtcagcgag
gtttacctaaacgacagtcctgtcaaattcgcatacaatatcaacacgaagaacttgagt
atctttggtatccaagtggacatgaagcgaccattcgtatttacttggacctacatgccg
tttttttaa

DBGET integrated database retrieval system