KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105181912Help
Entry
105181912         CDS       T03918                                 

Definition
(RefSeq) transcriptional activator cubitus interruptus
  KO
K16799  transcriptional activator cubitus interruptus
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:hst00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04341 Hedgehog signaling pathway - fly
    105181912
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hst03000]
    105181912
Transcription factors [BR:hst03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, GLI-like
    105181912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_aberr FOXP-CC
Motif
Other DBs
NCBI-GeneID: 105181912
NCBI-ProteinID: XP_025153172
LinkDB All DBs
Position
Unknown
AA seq 1489 aa AA seqDB search
MPEKEVAYHQEAFSLLPPPPPPHHPHTAFYAAFHPHPHAPPPPTFHPHHGPPPPPPPHPT
HSVTGWEHHITAAAFHAPPHHPLSGSTTAIGAVGNGSGGGGGGGGGSGGSGGGGGGGGGG
GGSGGGGSGAAGNGTSGGDFLRRSHPLSEHTALHPAYRINYMDHIYHQLQASTHSPNASL
HGLGGLGPEYILHAAGPASTLASSEFPFPIDVSASSRLGSPRASTIRASRKRALSSSPYS
DRFDIDNMIRFSPNSLTSIVNGSRSSSASGSYGHLSAAMSPALGMHPGMAPHLQQLQVQL
LRSAAAAALLPHTHSLQSPVPPPPPHPHSQPHVHGLSPHSQLYPGVPNHSTSSATLGPHG
AGVPPKSESAESCRKASESSTRSVTAEADTSSRRASTKVKREPATTTTNATTTTAPPTHP
QGLSPSEDLRDEPGDFIETNCHWRDCGLEFPTQDDLVKHINNDHIHANKKSFVCGWEECS
REEKPFKAQYMLVVHMRRHTGEKPHKCTFEGCFKAYSRLENLKTHLRSHTGEKPYTCEYP
GCSKAFSNASDRAKHQNRTHSNEKPYVCKAPGCTKRYTDPSSLRKHVKTVHGAEFYANKK
HKGGGGGGGDGGGSDEAGAGGHSPSRSEDLHPKTPSLSSPSVKSESEANSPPSMMQQQGS
PLVGGCNDEVAGVGALTGDGVALAEEPWNEEPDDLDIAVLPVALRAIVGGMESQQQQQAP
PPTSRNRLKGRLNAKGVSSLPIGVGNVRGVRGVTPQGNIGDLNRRITDLKMEGGGGGGGG
QTRQTSLSDLQLRLQPLSEPRRDSNSTESTSYGSMRSMDFGSRRSSQASGVSAVRMGPAG
PGSFYDPISAGTSRRSSQMSTTSGRMNPPSHLQGPYSTSNLVVQTQNMSLQSIQAMPGDW
SNPSGHCTQPSGDRRMSEPTRTNQTQRTSPPIPPRPRSAQLPELHPNQEVILDEVGEGEM
VENKLVIPDEMMQYLNQVQAGGSQVSYRGSPLPICQSPICTNSLHYQRQMQPTCNYNQPH
QPHQQNCYPQAQQAAQQPCYQNPVSSPYGQCPNSRATQPPSQYCPPPNYGSQVIGGGHVP
ASPASGQVMSPSSNYGPAHLSDQPLTSPAAGALAPQHAPQNLPQNSAQLSRNCPQNHAHH
AYYPTYGCAGQMSANCTGNTTGQANHHSSQTCAPSNHAVQMRLTTNCQQLSPHCAQPSAP
MANPPNLTHPNSQCSQSGQCTRPMVTSNGQIPNVHSAQQPSVTNQCGPMSPHCSQMNLVN
QQAKPMNAMTSLQNCQQQAQASPCLQIGNCTHPNGAHHAVNDSGASKRTSPQLCNAQQTS
NCRIQQQQQHPAQPQLQPQPQPQQQQQQQQQQQQQQTCTHNCQARTNPPTHQQYSCNCQW
AYGNQCYHDQHGGPLPEIQCRDISQSQQGPTIKLPQGMRQDSYRRTLEYVQQCRNWSGSS
QTHETNVSSSTHPMSLPQPLPASANMIVNDMTSSLSSLQHENRYLQMIQ
NT seq 4470 nt NT seq  +upstreamnt  +downstreamnt
atgccggagaaggaggtcgcttatcatcaggaggctttctccttgctgccgccaccgcca
ccgccgcatcacccgcacacggccttctacgcggccttccatccgcacccccatgcacca
ccgccgccgaccttccacccgcatcacggcccgccgccgccgccgccgccgcatccgacg
cactcggtgaccggctgggagcaccacatcacagccgcggccttccacgcaccgccacat
cacccattatccggcagcacgaccgcgatcggagcggttggtaacggcagcggtggcggc
ggtggcggcggcggaggcagcggcggcagcggcggcggcggcggcggcggcggcggtggg
ggtggcagcggcggcggagggagtggtgccgccggcaacgggacttccggcggagacttc
ctgcgcagaagtcatcccctctcggagcatacggccctgcatcccgcctatcggatcaac
tacatggaccacatttaccatcagctccaggcctccacgcacagtcccaacgcctcgtta
cacggactgggtggtttggggcccgagtacatcctgcacgcggcaggccctgccagcacc
ctagcgtcgtccgagttcccgttccccatcgatgtctcagcgtcgtcgagactaggcagc
ccgagagcctcgacgatccgagcgagccggaaaagggcgctgagcagttcgccgtactcg
gacaggttcgacatcgacaacatgattcgcttcagccccaacagcctgacgtcgatcgtc
aacggctcgcggagcagcagcgcgagcggcagctacggacacctctccgccgcaatgagc
ccggccttaggcatgcatcccggcatggcgccgcacctgcagcagctacaggtccaactt
ttgaggagcgcagccgcggcggcactcttacctcacacgcactccctgcagtcgcccgta
cccccgccgccgccgcacccccattcccagccgcacgttcacggattgtcgccgcactcg
caactgtaccccggtgtgccgaatcattccacatcgtcggcgaccctcggccctcacgga
gccggagtgccgccgaaaagcgagagcgcggaatcgtgtaggaaagcgtcggaatcgtcg
acccgctcggtgacggccgaagccgacacctcttcgagacgggcctccaccaaagtgaaa
agagaaccggcgacgacgaccaccaacgcgaccacgactaccgctccaccgactcatcct
caaggtctcagcccgagcgaggacctccgagacgagcctggcgatttcatcgagacgaat
tgtcactggagggactgtggtctcgagttccccacacaggacgatcttgtgaagcacatc
aacaacgatcacatacacgccaacaagaagagctttgtctgcggttgggaggaatgctcg
agggaggaaaaacccttcaaggctcagtacatgctggtcgtgcacatgagaaggcacacc
ggggaaaaacctcacaagtgtacctttgagggctgcttcaaggcttactcgcgcctggag
aatctgaagactcacctcaggtcccacaccggtgagaaaccgtatacttgcgagtacccg
ggttgcagcaaggccttcagcaacgccagcgacagagcgaagcatcagaacaggacgcac
tccaacgagaaaccgtacgtgtgcaaagctcccggctgcaccaagaggtacacggaccca
tcgtccctgaggaaacacgtgaagaccgtccacggggcggaattctacgcgaacaagaag
cacaagggcggcggcgggggcggcggtgacggaggcggcagcgacgaggccggcgcaggt
ggccacagtcccagcagaagcgaggacctccatccgaagacgccgagtctgtcgagtccc
agcgtcaagtcggagagcgaagccaacagtccacccagcatgatgcagcagcagggtagc
ccactggtaggtggttgcaacgacgaagtcgccggagtcggcgctctcaccggcgacgga
gtggctctcgctgaggaaccgtggaacgaggagcccgacgacctggacatcgccgttctt
ccggtagctctacgtgcaattgttggcgggatggagtcgcagcagcaacaacaagcaccg
ccaccgacatctaggaaccgtctgaaaggtcggctgaacgccaagggcgtgtcaagcctg
cctatcggcgtagggaacgtgcggggtgtgcgtggcgtcacaccccaaggcaacatcggc
gacctcaacaggaggatcaccgatctgaaaatggaaggtggtggcggaggcggtggcggt
cagacgcggcagacgagtctgtcggacctgcagctgagattgcagccgctcagcgagccg
cgacgggacagcaacagcaccgagagcacttcctacggcagcatgagatccatggatttc
ggcagcaggcgaagcagccaggcgagcggcgtcagcgccgtcaggatgggcccagcggga
cccggcagtttctacgacccgatcagcgctggcacgtccagaagaagcagccagatgagc
accacttccggcaggatgaatccgccgagtcacctccaaggaccttactcgacgagcaac
ctcgtcgtccagactcagaacatgtcccttcagagtattcaggcgatgccaggcgactgg
agcaaccctagcggccattgcacccaaccatcgggcgaccgacgaatgtcggagcctact
cgcaccaatcagacccaacggacctctcctccaataccgcccagaccgaggtcggcgcaa
ttgcctgaacttcatcccaatcaggaggtgatcctggacgaggtgggcgagggcgaaatg
gtggagaacaagctggtcattcccgacgagatgatgcagtacttgaatcaggttcaggct
ggtgggagtcaagtgagctatcgcggcagccctctgcccatctgccaatcgccgatatgc
acgaattccctgcactaccagcgtcagatgcagcccacgtgcaattacaaccaaccccat
cagccacaccagcagaactgctacccgcaggcccagcaggctgctcagcaaccctgctat
cagaatcccgtctcctcgccctatggccaatgtccgaattcacgcgcgactcagccaccg
tcgcaatactgtccaccgccgaattacggctcccaagtgatcggcggcggccacgtgcca
gcgagccctgcctccggccaggtaatgtcgccgagttctaactacggtccagctcacttg
agcgatcagccactgacgtctcctgcggcgggcgccttggctccgcaacatgcgccgcaa
aacctgccgcagaactcggctcagctctccaggaactgcccgcagaaccacgcgcatcac
gcttactacccgacttacggctgcgctggtcagatgagtgcgaattgcaccggcaatacc
accggtcaagccaaccatcattccagccagacctgcgcgccgtctaatcacgccgtgcag
atgaggctaacgaccaattgccagcaactgtcgccgcattgcgcgcagccgtccgcgccc
atggctaatccaccgaacttgacccatccaaactcacaatgcagccagtccggtcaatgc
acgagacccatggtgacgtccaacggtcagatacccaatgtacactcggcccaacaacca
tcggtgacgaaccagtgcggcccgatgtcgccgcattgttcccagatgaacctcgtgaac
caacaggccaagccgatgaacgccatgacgagtcttcagaactgccaacagcaggcccaa
gcgtcgccgtgcctgcaaatcggcaattgcacccacccgaacggcgcgcatcacgcggtc
aacgacagtggtgcgtccaagagaacgtcgccgcaactttgcaacgctcaacagaccagc
aactgcagaatacagcaacaacaacagcatccagcacagccgcagctgcagccacagcca
cagccacagcagcagcagcagcagcagcagcaacagcagcaacagcagacctgcacgcac
aattgtcaggcgcgcacgaaccccccgactcatcagcagtacagttgcaattgccaatgg
gcgtacggcaaccagtgctatcacgatcaacatggtggcccgttgccggagatacagtgc
agggacatcagccagtcgcagcagggcccgacgatcaagctgccgcaaggtatgcgacaa
gattcttaccgcaggacgctggagtatgtccagcagtgcaggaactggtccggcagctcg
caaacgcacgagaccaacgtgtccagctcgacacacccgatgtcgttgccgcagccgctc
ccggctagcgccaatatgatcgtcaacgacatgacgtcctcgctcagctctttgcagcac
gagaacaggtacttgcagatgattcaatga

DBGET integrated database retrieval system