KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105183921Help
Entry
105183921         CDS       T03918                                 

Definition
(RefSeq) activating transcription factor of chaperone isoform X1
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst04137  Mitophagy - animal
hst04141  Protein processing in endoplasmic reticulum
hst04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:hst00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105183921
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    105183921
  09143 Cell growth and death
   04214 Apoptosis - fly
    105183921
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hst03000]
    105183921
Transcription factors [BR:hst03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    105183921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF3450 WD40_alt
Motif
Other DBs
NCBI-GeneID: 105183921
NCBI-ProteinID: XP_011140661
UniProt: E2BKP3
LinkDB All DBs
Position
Unknown
AA seq 369 aa AA seqDB search
MEFNQDKEMQEWKVEPVSPSRAPSLGLDDWDIFDDKLIEFPNDVTESMMYDEKLNRAQVA
TKTLEEIEMDEWIKEEPFSAWMEQRTLIPIYEELPIPTEDESQTNEIGYQADILKPQQQD
NTQSLLEEFETVLEDVEACHQIPPTSSLTPPQSPLPQQTRQQTATVNTQLLTALQPVRQP
PLFISNESETVYNTIASSVENSYVNRAPPSDHWTAVENESFESLDRDELAVADEYVRSHT
KDVQSPSSPCTSSGSSCTSAEDLVDDPDWSVESEKSKRKPSSSRHHLKPYQCSRPSIEDK
KVRKKEQNKNAATRYRQKKKQEIKEIQCEEHQLTEINEKLKNDLADLQREIKFMKKIMRD
VFKIHGILR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggaattcaaccaagacaaggagatgcaggagtggaaagtcgagccggtgtcccctagt
agggcaccgtcattgggacttgatgactgggatatatttgacgataagcttatagaattt
ccaaatgatgttacggaatctatgatgtatgatgaaaaattgaatcgtgcacaagtagct
acaaaaacattagaagaaattgaaatggatgaatggattaaagaagaaccattttcagcc
tggatggaacagagaacattaatacctatatacgaagaactgcctattccaaccgaggat
gaaagtcaaaccaatgagattggttatcaagcggatatcttgaaaccgcaacaacaagat
aatacgcaaagtcttttagaagaattcgagacagttttggaagatgtcgaggcttgccat
cagattccaccgactagctcgttaactcctccgcaatcgccattgccgcagcaaacgcgg
caacagactgcaactgtaaacacgcaactgttgactgctctgcaacctgttcggcaacca
ccgttgttcatcagcaacgaatccgaaacggtctacaatacgatagcatcatcagttgag
aactcatatgtaaacagggcaccaccatctgatcactggaccgccgtcgaaaacgaatcg
tttgaatcgttagatagagacgaattggcggtggcggacgagtacgttcgctcgcacacc
aaggatgtacaatcaccgtcgagcccgtgcactagctccggcagtagttgcacctcggca
gaggacttggtcgatgatcctgactggagcgtggagagcgagaaaagcaagcggaagccg
tcgagttcaagacatcatcttaaaccttatcaatgctctcggccatccatcgaggacaag
aaagtgcggaagaaagaacaaaataaaaatgcggcgacgcgttacaggcaaaaaaagaaa
caagaaattaaagagatacaatgtgaagagcatcagttaacggaaattaatgaaaaattg
aaaaatgatttggccgacctgcaacgcgagatcaaatttatgaagaaaatcatgagagac
gtatttaaaattcatggtattcttcgttaa

DBGET integrated database retrieval system