KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105184373Help
Entry
105184373         CDS       T03918                                 

Definition
(RefSeq) histone-lysine N-methyltransferase E(z) isoform X2
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:hst00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    105184373
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hst03036]
    105184373
Enzymes [BR:hst01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105184373
Chromosome and associated proteins [BR:hst03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105184373
   Polycomb group proteins
    PRC2-EZH2 complex
     105184373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 105184373
NCBI-ProteinID: XP_011141418
LinkDB All DBs
Position
Unknown
AA seq 766 aa AA seqDB search
MSKAKVSAEWRKRVKSEYMRLRQMKRYKRADEVKIAWNQNHKTMTELLMAEQKRWADGKA
MWLAMQDIPPHLSCMKKAEVTSSDGDVQTCPVKIINAVTPIPTMYTWAPIQQNFMVEDET
VLHNIPYMGDEILDQDGTFIEELIKNYDGKVHGDREAGFMDDSIFVDLVNALVNYEKEDK
EKEQTKKGKEPLREKDNQKEDEKKDIEGRSEIKIEKIENGKTLTVPFPSMHIFNAISSMF
PDKGRPEELKEKYIELTERSDPNVLPPECTPNIDGINAKSVPREQTMHSFHTLFCRRCFK
YDCFLHPARGTSPQGLQVCHPGPNLLKRKGPDLKPFSEPCGTECYMHLEGMKEKLAAQAA
DIKDEEGDEKRGGPPRKVRKQASVDSGNEASSEDSNDSNKYSQGGSCQDFKQNVNKDTRS
EEMIEDQAQPENQTPFTLLGLDKRIKMDNKFTWTGSEQSLFRALHKAFPGNPCALAQIML
TKTCKEVYEFAQKEASDIPAIENLKDFTPPRKKKKKHRLWSMHCRKIQLKKDSGANHVHN
FAPCDHPGRQCDNSCPCIQAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRE
CDPDLCQTCGADHFQINSISCKNVSVQRGLHKHLLMAPSDVAGWGIFLKESAAKNEFISE
YCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSINPNCYAKVM
MVNGDHRIGIFAKRAIQPGEELFFDYRYGPTEQLKFVGIEREMEFL
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaggcaaaagtttcggcggaatggaggaaacgagtgaaatcggaatatatgcgt
ttacggcaaatgaaacgctacaagcgtgcggacgaagtcaaaatcgcgtggaaccagaat
cacaaaactatgacggaacttcttatggctgaacaaaaacgttgggccgatggaaaggcc
atgtggttagctatgcaagacattccacctcatctttcctgtatgaagaaagcagaggtt
actagttcagatggtgatgtgcaaacgtgtcctgtgaaaataattaatgcggtaactcct
ataccaactatgtatacgtgggcacccattcagcagaactttatggtagaagatgaaact
gttttacataatattccttacatgggtgatgaaatcttggatcaagatggtacttttatc
gaagagcttatcaagaattatgatggaaaggttcatggtgatagagaagctggttttatg
gatgattccatctttgttgatctggtgaatgcactggtaaattatgaaaaagaagataaa
gaaaaggaacagacaaaaaagggaaaggaacctctgagagaaaaagataatcaaaaagaa
gatgaaaaaaaggatattgaaggaagatctgaaataaaaatagagaagattgaaaatgga
aagacattaactgttccattcccatcaatgcatatattcaatgcaatatcaagcatgttt
cctgacaaaggcagacctgaggagttgaaagaaaagtatattgaattaacagagagatca
gatccaaatgtcttgcctccagaatgtacgcctaatatagatggtataaatgcaaaaagt
gtgcccagggaacagacaatgcattcctttcatactttgttctgcagaaggtgctttaaa
tacgactgttttttacatccagccagggggacttcgccgcaaggtctccaagtttgccac
ccgggacctaatttattgaaacggaaaggacccgacttgaaaccattctcagagccgtgc
ggaacggaatgttatatgcatttagaaggaatgaaagaaaaactggcggcacaagcggca
gacatcaaagacgaagaaggtgacgaaaagcgcggtggtcctccgagaaaggtgcgaaag
caagcgagcgttgattcaggaaatgaggcgagcagtgaagatagcaatgatagcaataaa
tatagtcaaggaggcagttgccaagattttaagcagaatgttaataaagacacaagatcg
gaagaaatgattgaagatcaagcgcagcctgagaaccaaacgcctttcactctgttgggt
cttgacaaacgaattaaaatggacaacaagttcacgtggacaggttccgagcagagcttg
ttccgtgctttacacaaggcctttcctggtaatccgtgtgcgttagcgcaaatcatgtta
acaaaaacatgcaaggaagtttacgaatttgcgcagaaagaagcttcggacattcctgct
atagaaaatctcaaggacttcacaccgccgcgaaaaaagaaaaagaagcatcggttgtgg
tctatgcattgccggaaaatacaacttaagaaggactcgggtgctaatcacgtgcacaat
tttgcaccttgcgatcatcccggccgtcaatgtgataattcatgcccgtgtatacaagca
caaaacttctgcgagaagttttgtcagtgcagcagtgaatgccagaacagatttcctggg
tgtaggtgcaaggcgcaatgcaacacaaagcaatgtccttgttatctggccgtcagggaa
tgtgatccggatctttgccaaacgtgtggcgcggatcatttccaaattaattctatatct
tgcaaaaatgtcagcgtgcaacgtggtcttcacaaacatcttctgatggcgccatccgat
gtagcgggctggggaatttttttgaaagaatcagcagcgaaaaatgaattcatctcggaa
tattgcggcgaaattatcagtcaagacgaagctgacaggaggggaaaagtatatgataaa
tatatgtgtagtttcctctttaatcttaacaatgattttgttgtagacgctacacggaaa
ggaaataaaataaggttcgctaatcactcaataaatccaaattgttatgcgaaagtgatg
atggtgaacggtgatcatagaataggtatttttgcaaagagagcgattcagccgggtgaa
gaattattttttgattatagatatggaccaacggagcagttaaaattcgtcggtatcgag
cgagaaatggagtttctctaa

DBGET integrated database retrieval system