KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105184605Help
Entry
105184605         CDS       T03918                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst04146  Peroxisome
hst04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hst00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105184605
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105184605
Enzymes [BR:hst01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     105184605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 105184605
NCBI-ProteinID: XP_025158148
LinkDB All DBs
Position
Unknown
AA seq 155 aa AA seqDB search
MTVKAVCVLQGEPVKGTLYFEQAEGSNTVKVTGEVSGLQKGLHGFHVHEFGDNTNGCTSA
GAHFNPLGKEHGGPSHAVRHVGDLGNVEADANGVAKVNITDSIIQLCGPHSIIGRTLVVH
ADPDDLGQGGHELSKTTGNAGARLACGVIGITKAQ
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcaaagcagtctgtgtccttcagggtgaacctgttaaaggaactttatatttc
gaacaagcggaaggttcaaatacagtaaaagtgactggagaagtttctggcttgcagaaa
ggcttgcatggtttccatgttcatgaatttggtgataataccaatggttgtacaagtgca
ggtgctcatttcaatccattgggaaaagaacatggtggtccaagccatgctgtgcgtcat
gttggagacttaggaaatgtggaggctgatgccaatggtgttgctaaagttaacattact
gattccataatacaattgtgtggaccacatagtattattggacgaactcttgtggttcat
gctgatcctgatgatttgggtcaaggtggtcatgaactttcaaagactactggcaatgct
ggtgctcgtcttgcttgtggtgtcattggtattacaaaggcacagtaa

DBGET integrated database retrieval system