KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105184626Help
Entry
105184626         CDS       T03918                                 

Definition
(RefSeq) probable aspartate aminotransferase, cytoplasmic isoform X1
  KO
K14454  aspartate aminotransferase, cytoplasmic [EC:2.6.1.1]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00220  Arginine biosynthesis
hst00250  Alanine, aspartate and glutamate metabolism
hst00270  Cysteine and methionine metabolism
hst00330  Arginine and proline metabolism
hst00350  Tyrosine metabolism
hst00360  Phenylalanine metabolism
hst00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hst01100  Metabolic pathways
hst01200  Carbon metabolism
hst01210  2-Oxocarboxylic acid metabolism
hst01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hst00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105184626
   00270 Cysteine and methionine metabolism
    105184626
   00220 Arginine biosynthesis
    105184626
   00330 Arginine and proline metabolism
    105184626
   00350 Tyrosine metabolism
    105184626
   00360 Phenylalanine metabolism
    105184626
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    105184626
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hst01007]
    105184626
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hst04131]
    105184626
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hst04147]
    105184626
Enzymes [BR:hst01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     105184626
Amino acid related enzymes [BR:hst01007]
 Aminotransferase (transaminase)
  Class I
   105184626
Membrane trafficking [BR:hst04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    105184626
Exosome [BR:hst04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105184626
  Exosomal proteins of other body fluids (saliva and urine)
   105184626
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 DUF3991 TetR_C_28
Motif
Other DBs
NCBI-GeneID: 105184626
NCBI-ProteinID: XP_011141818
LinkDB All DBs
Position
Unknown
AA seq 419 aa AA seqDB search
MNSRFTGIKLGPPIEVFALQKAFVDDTHEKKVNLTIGAYRTNEGKPWVLPVVRKVEKSLA
VDELQNHEYLPVLGLDAFSEAATSMLLGANSPVIAQGRAFGIQSLSGTGALRVTAEFLSH
ILQYDTFYYSKPSWDYVLAENHRLVFTNGGFKHACEYTYWDEKTRSIDIEGMLNDLKNAP
ENAVIILHACAHNPTGCDPTPEQWARIADVIEEKRLFPLFDSAYQGFASGDLDKDAYAVR
MFAERQIEFICTQSFAKNFGLYNERVGNIVFVLADTKEIVQAKSQLTLIVRGMYSNPPNH
GARIVATVLRNPELFEEWREHIRTMSDRIRQMRIGLHHRLIKLGTPGVWDHIVQQIGMFS
YTGLTEKQVQHLRDHYHIYMLRSGRINMCGLNESNLDYVANAIHETVTLLSEAWGDCMC
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcagatttaccgggattaaactgggacctcccattgaggttttcgcactgcaa
aaagcatttgtcgacgatactcacgaaaagaaagtcaatcttactataggagcttatcgt
accaatgaaggtaaaccatgggtcctaccagttgtaagaaaggtagaaaagtcgcttgct
gttgatgaactacaaaatcatgagtatttgccagttcttggtttagatgcatttagcgag
gctgctacaagtatgttattgggtgcaaattctcctgttatcgcccaggggcgtgccttt
ggtattcagtcactttcgggtacaggggcactacgtgtcactgcagaatttttgagtcat
attctacaatatgatactttttactatagtaaaccttcttgggattatgtgctggcagaa
aatcatagactggtatttactaacggaggatttaaacatgcttgcgagtatacgtattgg
gacgagaaaacgcgcagtatcgacatcgaaggtatgctcaatgatctgaaaaacgctcct
gagaacgctgtaattattttgcatgcatgcgcacataatcccactggatgcgatccgact
ccagaacaatgggctaggattgctgatgtgatagaggagaaacggctcttcccgttgttt
gatagtgcgtatcagggttttgcgagtggtgatctagacaaagacgcatacgccgtacga
atgttcgctgaacgtcaaatcgaattcatctgcacacaaagcttcgccaagaactttgga
ttgtacaatgaaagagttggtaacatagttttcgtattggctgacacgaaggagatagta
caagccaagtcgcaattaacattaatcgtccgaggaatgtacagtaatcctcctaatcac
ggcgctcgaattgtcgcgacggtgctgagaaatccagagctctttgaggaatggagggaa
catatcagaacaatgtctgatagaatcagacaaatgagaataggtttgcatcacagactg
atcaaattaggcactccaggtgtttgggatcatattgtccaacagattggaatgttctcg
tacacaggacttactgaaaagcaagtgcagcatttgagagaccattatcatatctatatg
ctacgcagcggccgtataaatatgtgtggactcaacgaatcgaacttggattatgtggca
aatgcgatccacgaaacggtaacattattgtcggaagcatggggcgattgtatgtgttaa

DBGET integrated database retrieval system