KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105184631Help
Entry
105184631         CDS       T03918                                 

Definition
(RefSeq) maltase 2
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00052  Galactose metabolism
hst00500  Starch and sucrose metabolism
hst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105184631
   00500 Starch and sucrose metabolism
    105184631
Enzymes [BR:hst01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105184631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 105184631
NCBI-ProteinID: XP_011141825
UniProt: E2BMX6
LinkDB All DBs
Position
Unknown
AA seq 573 aa AA seqDB search
MMFRLCMSLVALVALSASAAVQKANKDWYKNSLVYQIYPRSFKDSNGDGIGDLNGITSKL
EHIADIGAHALWLSPIYTSPQLDFGYDVANFTDVDKDYGTLADFDRLVAKAKSLGLKVIL
DFVPNHSSHEHEWFKKSVQRIKPYDEYYVWSDGKIVNGSRRPPNNWLSVFQGSAWEWNPT
RKQYYLHQFAVGQPDLNYRNAALQQEMKNVLKFWMNHGVEGFRIDAINHIYEDARLLDEP
RRNVSGLPDDDYDTLDHIYTKNLLETYDVLKSWRQLLDDHSKAADTKMILTEAYTTFNLT
ILFYKSGSNVPFNFMLISDLNNKSNAADFKLLIDRWINHLPDNSAYVANWVVGNHDNHRA
ASRFGVKRADQLSMLATVLPGVSVIYNGDEIGMVDRPFTYEETVDPAGCNAGPERYHLKS
RDPERTPFQWDNSTSAGFSSSSKTWLPVHDNYKSLNLAAQKTAVVSHYKVFKSLAWLKRK
PVIERGTLQIVLVTERILGVVRRHGASTVALMVNFADTPLTVDARTWMNIPEQLIVYASS
VHSKLLAGWRVDTTRVIVPASASVVLATEDLLQ
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgatgttccgcttgtgtatgtcactcgtagcgctggttgctctgtccgcctcagcggcg
gttcagaaggccaacaaagattggtacaagaacagtctggtatatcagatctacccgagg
agtttcaaggatagcaacggcgacggtataggcgatttaaacggtatcacgagcaagctc
gagcacattgcagacatcggcgctcacgcgttatggttgtcaccgatctatacgagtccg
cagctggactttggctacgacgtcgccaatttcaccgacgtcgacaaggattacggcacc
ttggccgacttcgaccggctcgtggcaaaggccaagtccctcgggctcaaagtgatcctc
gacttcgtgccgaatcatagctcgcatgagcacgagtggttcaagaagagcgtccaaagg
atcaaaccgtatgacgagtactacgtgtggtccgacgggaaaatagtaaacggcagcagg
aggccgcccaacaactggctgagtgtattccagggttccgcctgggagtggaatccgacg
cgtaaacaatattacctgcaccaattcgccgtcgggcagccggatctcaactatcgcaac
gccgcactgcagcaagagatgaagaacgtgctgaaattctggatgaatcacggagtggag
ggcttccgtatcgacgctatcaatcacatctacgaggacgcccgtttactggacgagccc
cgaagaaacgtgtccggtctgccggacgacgactacgacaccctggatcacatctacacg
aagaatctactcgagacctacgacgttcttaagtcgtggcgacaactgctggacgaccac
tccaaggccgccgacacgaagatgatcttgaccgaggcctacacgaccttcaatctcacc
atactattctacaagtcgggctcgaacgtgcccttcaacttcatgctgatcagcgacctc
aacaacaagtccaacgcggctgactttaagctgctgatcgatcgctggatcaaccatctg
cctgacaattccgcctacgtcgcgaattgggtggtgggcaatcacgacaaccatcgcgct
gcctcgcgattcggagtcaagcgagccgaccagctgtccatgttggcgaccgtcttgcct
ggcgtcagcgtgatttacaacggcgacgagatcggcatggtcgaccgaccgttcacgtac
gaggaaacggtggatcccgccggatgcaacgcaggccccgagaggtatcatctgaaatca
cgggacccggagagaacgcccttccagtgggacaacagtacgagcgccggtttctccagc
agcagcaagacctggcttccggtccacgataattacaagagcctgaatctggcggcgcag
aagaccgcggtcgtgtcgcattacaaagtattcaagtccctggcgtggctgaagaggaag
cccgtcatcgagcggggcacgctccagatcgttctggtgaccgagaggatcctcggggtg
gtgcgacgacacggcgcgtccaccgtggcgctcatggttaacttcgccgacactccgctc
accgtcgacgccaggacctggatgaatattcccgagcagctgatcgtctatgcgtccagc
gtgcactccaagctgctcgcgggatggcgcgtcgacacgactcgcgtcattgtgcccgcc
tcggcctctgttgtgctcgccacggaggatttgcttcagtaa

DBGET integrated database retrieval system