KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105185095Help
Entry
105185095         CDS       T03918                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst04140  Autophagy - animal
hst04213  Longevity regulating pathway - multiple species
hst04310  Wnt signaling pathway
hst04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:hst00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105185095
   04341 Hedgehog signaling pathway - fly
    105185095
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105185095
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105185095
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hst01001]
    105185095
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hst03019]
    105185095
   03036 Chromosome and associated proteins [BR:hst03036]
    105185095
Enzymes [BR:hst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     105185095
Protein kinases [BR:hst01001]
 Serine/threonine kinases: AGC group
  PKA family
   105185095
Messenger RNA biogenesis [BR:hst03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     105185095
Chromosome and associated proteins [BR:hst03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    105185095
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Bac_GDH
Motif
Other DBs
NCBI-GeneID: 105185095
NCBI-ProteinID: XP_025160125
LinkDB All DBs
Position
Unknown
AA seq 353 aa AA seqDB search
MGNNAATANKKVDAAESVKEFLDKAKKEFEDKWKKNPTNTAALDDFERIKTLGTGSFGRV
MIVQHKPTKEYYAMKILDKQKVVKLKQVEHTLNEKRILQAISFPFLVSLRFHFKDNSYLY
MVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQ
GYLKVTDFGFAKRVQGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPP
FFADQPIQIYEKIVSGKPRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKGHKWF
ASTDWIAVFQKRIEAPFIPRCKGPGDTSNFDEYEEETLRISLTEKCAKEFAEF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaatgccgcgaccgctaacaagaaggtcgacgccgccgagagcgtcaaggaa
ttcctcgataaggcgaagaaggagtttgaggacaagtggaagaaaaatccgaccaacacc
gccgctctggacgacttcgagcgcatcaagaccctcggcacgggttcgttcggccgcgtc
atgatcgtccagcacaaacctaccaaggagtactacgccatgaagatactcgacaagcag
aaggtggtgaagctgaagcaggtcgagcacacgctcaacgagaagaggatactgcaggcg
atcagtttcccgttcctggtgtcgttgcgcttccacttcaaagacaactcttacctgtac
atggtgttggagtacgtccccggcggcgagatgttcagccacttgcgcaaggtcggccgc
ttctcggagccgcactcgcgcttctacgcggcgcagatcgtgctcgcgttcgagtacctg
cactacctcgacctcatctaccgggacctcaagccggagaacttgctcatcgactcgcag
ggctacctcaaggtcaccgactttggcttcgccaagagggtgcagggcagaacgtggacc
ctgtgcggcacgcccgagtatctcgcgcccgagatcatcctcagcaagggctacaacaag
gcggtcgactggtgggccttgggtgtgctcgtctacgagatggccgccggttatccgccc
ttcttcgctgaccagccgatccagatctacgagaagatcgtcagcgggaagccgcgcttc
ccctcgcactttggctcggaccttaaggacctgctgcgtaacctgctgcaggtcgacctc
accaagaggtacggcaacctcaaggcgggcgtcaacgacatcaagggccacaagtggttc
gccagcaccgattggatagccgtcttccagaaaagaatagaagcgccgttcataccgcgc
tgcaagggaccaggcgacaccagcaatttcgatgagtacgaggaggaaaccctgaggatc
tcgctgaccgagaagtgcgccaaggagttcgccgagttttga

DBGET integrated database retrieval system