KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105185248Help
Entry
105185248         CDS       T03918                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:hst00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105185248
Enzymes [BR:hst01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105185248
Chromosome and associated proteins [BR:hst03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105185248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 Hormone_1 Methyltransf_4
Motif
Other DBs
NCBI-GeneID: 105185248
NCBI-ProteinID: XP_011142882
LinkDB All DBs
Position
Un
AA seq 1358 aa AA seqDB search
MELRLHSPAGAEPIVYQWPLTSGSGSDRHDGALDVVETMRWVCEDLPDLKLPLENNILCN
YDTRDYESMKNLCDRFNRAIDSLVQLEKGTSLPSQRLNKRPSRGLLRHILQQTYNQAVVE
PDKLNQYEPFSPEVYGETSYELVCQMIDQIDVTENDVFVDLGSGVGQVVLQMAAATLCKI
CIGVERADVPSKYAQSMEVNFRKWLNWYGKRCGEYRLVKGDFLADEHRESITGATIVFVN
NFAFGPTVDHQLKLRFADLRDGARIVSSKSFCPLNFRITDRNLSDIGTIMHVSEMSPLKG
SVSWTGKPVSYYLHVIDRTKLERYFHRLKNNKQGGLDENSDSVISNTASNSSKVSNRNDR
SDRAKRDLSRQLDSPNHSEQLGTNSDSDLDDSTMKSRRQPNKIRRKLNRKSNGITKAPAR
GRQRGRGVKRAKPKKAINISGLDLLHSQTLLSTSPQALGKKPPPAPGCVDQQLSSLSLSL
QSHSTSVHEELSIPPAPSATPYALQILLDMYRYAFNTSYILAHAALEVYSQRGQSMDQFM
ILLESMRTPSYRVSVNTDISKERERNSKLQSRAAQLEKQIKVLIDDSVALLKARMTELGI
NATSPGDLLAKAKEIVLRHKQLQAKASKLQAQVASMETEQSRLVALRHQELQEKYNNHAS
ANGISNLSQSLTQDYILKEISATLSQRKRLHSQVSKLEHELNVLERTSNEKQAAAMAQQQ
RSDVMGTKLAQNLHLQSQVGKSGTTRKNREGRTRSHEWPDVPDIGKIQENNPEILAQKIL
ETGRQIEAGRIQNRQNTNINNNSRTRLPQASLSFSTTSSSISSTQSQIVNKDALSRTQEP
PRVANFEDRLKSIITSVLNEDQQNRNKQQLQLQVQMQNQSEPEKKRLSLPQNVSTPDYTQ
VSPAKLALRRHLSQERLSSSHLTSSDRPTVDSRQSSSHDNRLVAGGNGLLGARTIGELVN
GEIERTLEISNQSIINATVDMSAMIRPETVYSPISRPASAEGDAGLSTLAHVASYAPISS
GISTSTPTTSSRSSVLFTPVTQPQRYTPVQLPRADIKPYHESYFADNLSQSQTQSHPTTP
SLHSSQSASNGELLPVEGLAASLHARILNNSNSNSKVDLTLSNGNRSSRFQPYSRYTCTS
NNNANATTSGTVTALCQSQPAVSIKTETVVSSVSGASLSPLVEPHSNMSTPLVDEPQMTT
RRQRNAMADDDGEADWQDRISSGFDRLVAFASTELDKRRRSTEGVNTSPDSGLGSDSAVT
GPPPVVPSPDEALGPPRTPSPTSPRPPNPSNGNPPNGASTSSVPLKYQRQPDPERHHYKK
KFFHRDWNNSASTSKFRPKGKDWDWNHCGQWPSNDEQS
NT seq 4077 nt NT seq  +upstreamnt  +downstreamnt
atggagctacgtttgcactcgccagcgggagcggaaccgatcgtgtatcagtggccgctc
acttccggctcgggatctgaccgtcatgatggagcactggacgttgtcgaaaccatgcga
tgggtttgcgaagatttgccagacctgaaattacctttagaaaataatattctttgtaat
tacgataccagagactatgaaagtatgaaaaatttatgcgacagattcaacagagcaatt
gatagtttagtacaattggagaaaggcactagtctaccatcccagagactaaataagaga
cctagtaggggtttacttcgtcatatattgcagcaaacatataatcaagctgtggttgag
ccagataagttaaatcagtacgagcctttttcacctgaggtatatggcgaaacgagctat
gagcttgtatgtcagatgatcgatcagattgacgtgacagagaatgatgtctttgttgat
ctgggttccggagttggtcaagtggttcttcaaatggcagctgctaccttgtgcaaaatt
tgcataggtgtagagagggccgatgtaccatcgaaatacgcacagagtatggaagtgaat
tttcgcaaatggttaaattggtacggaaaacggtgtggggagtaccgtttggtgaaaggg
gactttttagcagatgaacaccgcgaaagcattaccggagctacgatagtgtttgttaat
aactttgcgttcggcccaacggtggatcatcaattaaaattacgcttcgccgatttacgg
gacggcgcgcgtatagtatcgtcaaaatcgttctgtccgttgaactttcgaataacagat
agaaatctcagcgatatcggcacgataatgcacgtatctgagatgtcaccgttaaaaggc
tccgtctcttggactggtaagccggtgtcttattatttgcacgttattgatcgaactaaa
ttagaacgttacttccaccgcttgaagaacaataaacaaggtggcttagatgaaaactct
gattctgtgataagcaacactgccagcaatagtagtaaggtttctaataggaacgataga
agtgacagagccaagagagatctttcgaggcaattagatagcccgaatcattcggaacaa
cttggaacaaatagcgattccgatctggacgacagtactatgaaaagtcgtcggcagccg
aataagatacggaggaagcttaacaggaagagcaatggcattacgaaagctccagctaga
ggcagacagagaggacggggtgtcaaaagagctaagcctaagaaggcgattaatatttct
gggttagacctgttacacagtcaaactttactcagtacatcaccccaggctctcggcaag
aagccgccgcctgcgcctggttgtgtagatcaacaactttcttcgttatcgctttctttg
cagtcgcattccacctccgtacatgaggaacttagtataccacctgctccgtccgcgact
ccgtatgctttacagatacttctggacatgtacaggtatgcatttaataccagctacata
cttgcccatgctgctctggaagtttattcacaaagaggccagtccatggaccaattcatg
attttgttagaatcgatgaggactcccagttaccgagtatccgtcaatacggatatctcc
aaggaaagagaaagaaattccaagcttcagtcgagagcagcgcagttggaaaaacagatc
aaggttctgatcgacgacagcgtggctcttttaaaggcgagaatgactgaattgggtatc
aatgctacatcacctggagatctactggcgaaggccaaggagatagttttgcgacacaag
cagctgcaagctaaagcgagcaaattgcaagcgcaagttgcgtccatggaaactgaacag
agcaggctagtggcgctcagacatcaagaattacaagaaaagtacaacaatcacgctagt
gcaaacggcatatcgaatctatcccaatcgctcacgcaggattatatattgaaagaaatt
tccgctactctgtcccagcgcaagcgattacattctcaagtttcgaaacttgagcacgag
ttgaatgtattagagaggacaagtaacgagaagcaagcagctgccatggctcagcagcag
aggagcgatgtaatgggaactaaactcgcgcagaatttacatcttcagtcgcaggtcggc
aagagcggaacaacgcggaaaaatcgagaaggccgtaccaggtcgcacgaatggcccgac
gtgccggacatcgggaaaatacaggaaaacaatccggagatactggcgcaaaagatcttg
gaaacgggaagacaaatcgaggcaggtcgaatacagaacagacagaatacgaatatcaac
aataattccaggactagattgccgcaggcgtcgctcagtttctcgaccacgtcatcgtct
atctcatccacgcaatcacagatagtcaataaagacgcgctgagtaggactcaagaacca
cccagagtggctaatttcgaagatagattgaagagcataatcacaagtgtgttgaacgaa
gaccaacagaacagaaacaagcagcagctgcaattgcaagtgcaaatgcaaaatcagtcc
gagcctgagaagaaacgcctctcgttgccgcagaatgtctctactccggattacacgcag
gtttcacccgcgaaactagctcttcgccgtcatctatcgcaagaacgtctctcgtcatct
catttgacatcatccgacagaccgacggttgattctagacaatcatcgagtcatgacaat
cgccttgtggcaggtggaaatggattgctcggtgctagaacaatcggcgagctcgtcaac
ggggaaattgagaggaccttagagatatccaatcagtcaataataaacgccactgtcgat
atgagcgcaatgataagaccggaaactgtgtattcgcccattagcaggcctgcgagtgct
gagggtgacgctggtctatcgactttggcgcatgtagccagttacgcacctatctcctcc
ggaatttccacatccactccaacgaccagttcgagatcgtctgtgctctttactccggta
acgcaacctcaaagatacacgccggttcagttgccgcgagcggatatcaagccttaccac
gaatcgtactttgcggataatctctcgcagtcacaaacacaatcccatcccacaacaccg
tcgctacattcgtctcagagcgcatcgaacggagaattgttacctgtggaaggcctcgcg
gcctcgttgcacgctcgaatattgaacaactccaatagtaacagcaaagtcgacctgaca
ctttccaacggcaacagaagttctagatttcaaccgtactcgcgatacacatgcaccagt
aataataatgccaatgcgacaacaagcggcacagtgacggcgctttgtcagtcgcaacct
gcagtgtcaataaaaacggaaacagttgtatcgtcggtaagcggagcatccttgagtcct
ctcgtggaaccgcattctaatatgtcgacaccgctagtcgacgagccccagatgacgacg
cgaaggcaacgaaatgccatggctgacgacgacggagaagccgattggcaagatcgcatc
agctcgggattcgatcgcttggtcgcgtttgcttctacagagttggacaaacgcaggcga
tctaccgaaggagtgaacacaagtcccgacagcggattaggctcggacagcgcggtaacg
gggccgccgccggtagtaccgtcgcccgacgaagcattagggccgccaaggacaccctca
ccgaccagcccccgtcctccgaatccatccaacggtaatcccccgaacggcgcgtccacc
tcctcggtacctctgaaataccaacggcaaccggaccccgagcggcatcactataagaaa
aaattttttcatcgcgattggaataattctgcgagcactagcaagtttcgtcctaaaggc
aaggattgggattggaatcactgtggacaatggccttcgaacgacgaacaatcctaa

DBGET integrated database retrieval system