KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105185352Help
Entry
105185352         CDS       T03918                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00020  Citrate cycle (TCA cycle)
hst00190  Oxidative phosphorylation
hst01100  Metabolic pathways
hst01200  Carbon metabolism
Module
hst_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hst_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hst_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:hst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105185352
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105185352
Enzymes [BR:hst01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     105185352
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-GeneID: 105185352
NCBI-ProteinID: XP_025161957
LinkDB All DBs
Position
Unknown
AA seq 542 aa AA seqDB search
MYDTVKGSDWLGDQDAIHFLSREASRAVYELENYGCPFSRTDEGKIYQRAFGGQSLKFGK
GGQAHRTCAVADRTGHALLHTLYGQSLRYDVHYFVEYFALDLLMHGRCCKGILAWELETG
LLHRFRAHHTVIATGGAGRCYFSSTAAHTCTGDGMAFACRAGLPLQDMEFVQFHPTGIYG
SGILITEGSRGEGGKLVNCNGEYFMEKYAPVAKDLASRDVVSRAVTIEILEGRGCGKKKD
HIQLQLSHLPADLIKQRLPGISHLAWVFAGVDIKKDPIPVIPTVHYNMGGIPTNWRAQVL
TRENEEDRPIEGLWAAGETACASVHGANRLGANSLLEVVVFGKAIADQIDCLSRPGERHE
DLAPEIGEQTICRFDATRYAKGCIPVVELREEMQRTMQKYCAVFRTCDILQRACREMTRF
YTCDLPDLCVQDQSLIWNTELVEALELQNMMLVCMNIVYAAENRKESRGSHTREDYKERI
DEYDYSKPLEGQKKRPFTEHWRKHTLTWALGDGTICISYRPVIDTTLDETEAQHVPPTVR
VY
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacaccgtgaaaggctccgactggctgggcgaccaggacgccatacacttcctc
tccagggaagcctctcgtgcggtttacgagctcgagaattatggttgccctttcagtcgt
acggacgagggtaagatctaccagcgggctttcggcgggcaatcgttgaaattcgggaaa
ggcggacaagctcatcgaacttgcgccgtcgccgacagaaccggccacgcgctgcttcat
accttgtatgggcagagtcttcgttacgacgtacactacttcgtcgagtatttcgctttg
gacctgctcatgcacggtcgatgctgcaaaggtatcttggcgtgggaattggagaccggt
cttctgcatcgcttcagggctcaccatacggtgatcgcaacaggcggcgccggaagatgt
tacttctcctccacggcggcgcacacttgcactggcgacggcatggcgtttgcttgtcga
gcgggcttgccgctgcaggacatggaattcgtccagttccacccgaccggcatctacggc
agcggtatactcatcaccgaaggcagtagaggggaaggcggcaaactcgtgaactgcaat
ggagagtacttcatggagaaatacgcgcctgtagccaaggatctagcctcgcgcgacgtg
gtgtcgagagccgtaaccatcgagatattggagggaagaggttgcggaaagaagaaagac
catatacagttgcaattgagtcacctgccggctgacctgataaaacagagactaccgggg
atctcgcatctcgcttgggtgtttgccggagtggacataaagaaagatccaatccccgtg
attcccacggtgcattacaacatgggaggcatacctacgaattggcgtgcacaggtgcta
acgcgagagaacgaggaggacagaccgattgaaggtctctgggctgctggagagactgcg
tgtgcctccgtacacggtgctaatcgactgggcgctaacagccttttggaagtcgtagtc
tttggcaaagctatcgctgatcagatcgactgcctgagcagacccggtgaacgtcacgag
gacttggctccggagatcggcgagcagacaatctgtcgcttcgacgcgacccgttacgcg
aaaggttgtattcccgtagtcgagctgcgcgaggagatgcaacgtacgatgcagaaatat
tgcgcggtattccggacttgcgacatactgcaacgcgcatgcagagaaatgactcgattt
tacacttgcgatttaccggacttatgcgtgcaggatcagtctcttatttggaacaccgag
ctcgtcgaggccttggagctgcaaaacatgatgctcgtttgcatgaatatcgtttacgca
gctgaaaatcgtaaagaatcgcgaggctcacacactagggaggattacaaagagagaatc
gacgagtacgactattcgaagccgctcgagggacagaaaaaacgacctttcacagaacat
tggcgtaaacatacgctcacatgggccctgggcgacggaacgatttgcatttcttatcga
cccgttatcgacacaacgctggacgaaaccgaggctcaacacgtaccgcctacggtccgc
gtatattga

DBGET integrated database retrieval system