KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105185706
Entry
105185706         CDS       T03918                                 

Definition
(RefSeq) tripeptidyl-peptidase 2 isoform X1
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Brite
KEGG Orthology (KO) [BR:hst00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hst01002]
    105185706
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hst03110]
    105185706
Enzymes [BR:hst01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     105185706
Peptidases and inhibitors [BR:hst01002]
 Serine peptidases
  Family S8: subtilisin family
   105185706
Chaperones and folding catalysts [BR:hst03110]
 Intramolecular chaperones
  Subtilisin family
   105185706
SSDB
Motif
Pfam: TPPII Peptidase_S8 TPPII_N
Other DBs
NCBI-GeneID: 105185706
NCBI-ProteinID: XP_011143698
LinkDB
Position
Unknown
AA seq 1293 aa
MTSCPASIKRSTSHGGSGIRNMADVIDCNFPVWGLLPKKETGVTQFLTKYPEYDGRDVII
AILDSGVDPGAPGMQVTSDGKPKIIERFDCSGAGDVDTSKVVQAPDGYILGLTGRKLKVP
SNWTNPSGEYHIGLKNLYALYPAKLKERVVAERKKRLWDDGHKSALAEASRQLQEFESKN
SQLSTLEERLEKEELEARVEVLNSIEKKYCDVGPTYDCVVFHDGNIWRACIDTSEEGNLE
AGVFLGEYSITRNFAPLTQEDQLNISINVHDNGNTLEIVSLCSSHGTHVASIAAAYFPDN
PELNGVAPGAQIISLTVGDGRIGTMETGTAVVRAMIYIMQHKEKIHVINMSYGEHAHWSN
TGRIGELMNEVIDERGVIWVASAGNLGPALCTIGTPPDISSSSIISVGAYVSPDMMIAEY
SLREKMAGMPYTWSSRGPMIDGGTGVTVCAPGGAITSVPNFTLRKSQLMNGTSMASPHVT
GAVAILISGLLAKGCPYSPYSIKRALENTALYVSNLDPFAQGSGLLQVENAFDNLVSYCD
APERDVRFAINCGVNNSKGIHMRTGIIDRPKDYAITVEPVFMDSENIDPSRKIDFNLKLT
LVCGASWVQFPTHLDLMHMPRAFVIRVEASNLPEGVHATSVRAYDVTNIAKGPVFQIPVT
VIQPMTLPKTALLPDLTYANVLFKPNTIERHFILVPEDATWAVLRLRSTEKDKTGRFVIH
TIQLKPRMSCKTLEVNRIINVTSQSETVQPFAVQGGLILEVVIAKYWANLGDIFIDYSIE
FHGIHMINGNLTMQSGDGINRIELRSSLRNEEVVPSISLKSSVQILKPNESKIAPLRARD
IIPPSRQIYELQLTYTFHSAKATEVTPNAALLSDLLYESEYESQMWMIYDSNKQLICCGD
AYPSKYTIQKLEKGDYTLKMHIRHEKRDLLERLTDMPLLLSQKLSTPINLDIYASQSQAI
IGGKKMVAASIPPGHILPLYIAPMFNENNTENKISKGATLGSYLQGTLTFCKDDIGKKVD
SHLFKYILSEPTKKNSNTTTKSEKEKTMTKWDEYNEALRDLKCNWLAKLAPSIKPGEYAN
LLYGELKNIFSDHLPVHTAMLTSLDSPEARRHVPHDDLSENAIALANQIITVADAVITNI
DQDKLLAYFGLKNDQRPDAAKIKTSMEKQKSSLIEVLVKKGCALARLYVHGTKTGEEGSY
GHLLESVTHHWQEVQKFAEPTDNKVIILSLWHAHINNHYGRYLKLLTRYYEEKPLKEVDE
KCIEIARILGWEHWSRLITTSIPTRYPATYRSF
NT seq 3882 nt   +upstreamnt  +downstreamnt
atgacctcgtgcccggctagcatcaaacgatcgaccagtcacggtggcagtggcattcga
aacatggcagacgtcattgattgtaactttcctgtttggggcctgctgcctaagaaagag
acgggtgtcactcaattccttaccaaataccccgagtacgacggccgagatgtcatcatc
gcaatcctcgactcgggagtggatcccggagcaccgggtatgcaggtgacttcagatgga
aaaccaaaaattatcgaaagatttgactgtagtggagctggagatgtagacactagcaaa
gttgtacaagcaccagatggatatatacttggtctgactggtcgcaagttaaaggttcca
agtaattggaccaaccctagtggcgagtatcacattggtttgaagaatctatacgcattg
taccctgctaaattaaaagaaagggtagtagcagaacgtaagaagcgtctgtgggatgat
ggacataaatcagcacttgctgaggcttccagacagttacaggaatttgaaagcaaaaat
tcacaattatcaactttggaagaaagactagaaaaggaagaacttgaagctcgcgtcgaa
gtactgaacagcattgagaaaaaatattgcgacgtaggacctacctatgattgcgttgtt
tttcacgatggcaatatttggagagcgtgtatcgatacctccgaagagggtaatctagaa
gctggcgtcttcctcggtgaatattctatcacgagaaactttgctcctcttactcaagag
gatcaattaaatattagtattaatgttcacgacaacggaaacacattagaaattgtcagt
ttatgttcgagccatgggacacacgtggcgtcaatcgcagctgcatactttcccgataat
cccgaattgaatggagtcgcgccaggtgcccaaatcatttcgctgaccgtcggtgacgga
cgtatcggtacaatggaaactggaacggctgtagtacgagcgatgatctacataatgcag
cacaaggagaagatccatgttataaacatgagttacggtgaacatgctcactggtcgaat
acgggtagaataggagaactgatgaatgaagttatcgacgagcgcggtgtgatttgggtc
gcgtccgccggcaatctcggaccggctctgtgtacaattggaactcccccagacatcagt
tcaagcagtattattagcgtcggtgcttacgtgtcacccgacatgatgatagctgaatat
tccttgagggagaagatggcaggtatgccgtatacttggtcatctcgtggtccgatgata
gacggaggcacaggagtaacggtatgcgcgccaggaggtgctattactagcgtgccgaat
ttcactcttagaaaaagccagcttatgaatggcacaagcatggcgagtccgcacgtaact
ggcgcagtggctattcttatatcgggccttcttgccaaaggttgtccatattctccttac
agtatcaagagggcgcttgaaaataccgctctttacgtatccaacttagatccgtttgcg
caaggttccggtctgctgcaagttgaaaacgccttcgataatctcgtctcatattgcgac
gcccccgaaagggacgttcgatttgccatcaattgtggcgttaataatagcaaaggtatc
catatgagaacaggtatcatcgatcgcccgaaagattatgcgatcaccgttgaaccggtg
ttcatggatagcgaaaatatagatccatcacgcaaaatcgactttaatctcaaattaacg
cttgtgtgcggcgcctcatgggtccaatttccgacgcatctagacttgatgcatatgcct
cgtgcttttgttatcagagttgaagcttctaacttaccagaaggtgttcatgccactagc
gtacgagcgtatgatgtaaccaatatcgcaaaaggtccagtattccaaattccggtgaca
gttattcaaccaatgacgctaccgaagactgcacttcttcccgatttaacgtatgcaaac
gtattatttaagcctaatacgattgaacgtcattttattcttgttccggaagatgctacc
tgggcagttttaagattaagaagtacagaaaaggataagactggtagattcgtgattcac
actatccaattgaaacctcgtatgtcctgcaagacactcgaggttaatagaatcatcaat
gtcacatctcagtcagaaactgttcaaccatttgctgtccagggcggattaattttagaa
gtggttatcgcaaaatattgggcaaatctaggcgacatatttattgactattccatcgaa
tttcacggaattcatatgataaatggcaatcttacaatgcaatctggagatggaataaat
cgaattgaattgcgtagttctcttagaaacgaagaggttgtacccagcatttctttaaaa
tcatctgttcaaattttaaagcctaatgaatcgaaaattgctcctttacgagcgcgtgat
attattccgccatcacgacaaatatacgaactacaattaacatacacattccactcggca
aaagcaactgaggtcacgccgaacgctgcattgcttagtgatctgctgtatgaaagcgaa
tatgaaagtcaaatgtggatgatttatgatagcaacaaacaactgatatgttgcggagat
gcatatccatctaaatatacaatacaaaagttagaaaaaggagattacaccttaaaaatg
catatacgccacgaaaagagagatctattagagagactgacggacatgccgttacttctc
agtcaaaaactcagcacaccaataaatttagatatttacgccagtcagtcacaggctatt
atcggtggaaagaaaatggtagctgcatctattccacctggtcatattcttcccttgtac
atcgctccaatgttcaacgagaacaacactgaaaacaaaatatccaaaggcgctaccctc
ggtagttatcttcaaggtacattgactttctgtaaggacgatatcggaaagaaagtggat
agtcatttattcaaatatatattatctgaaccaaccaagaaaaatagcaacaccactacc
aagtccgaaaaggagaaaactatgacgaaatgggacgagtacaatgaggcgttgagagat
ctaaagtgcaattggctcgcaaaacttgcaccgtccataaaacccggcgaatatgccaat
ttgctgtatggggagctgaagaacatcttctcggatcacctgcccgtccatactgccatg
ttgacgtctttggattctcctgaagcacgtagacacgtgcctcacgatgatctctcggag
aacgctatcgcgcttgccaatcaaataataacagtcgcagacgccgtgatcactaatatc
gatcaagacaagcttctagcatactttggcctgaagaatgatcaacgtcccgatgcagct
aaaatcaagaccagtatggagaagcaaaaaagcagcttgatcgaggtgttagtgaagaag
ggctgcgcactggcgcgattgtacgtacatggcacaaagactggagaggagggatcttac
ggacatttactcgaaagcgttacgcatcattggcaagaagtgcaaaaattcgcagaacct
actgataataaggttattattctgtccttgtggcatgcgcacatcaataatcattatgga
cgttatttgaaattattgacacgctattacgaggagaaaccgctgaaagaagttgacgag
aagtgcatcgagattgcaaggatcctgggctgggaacactggtcgcgtcttattactacg
agtataccgacgcgttatccggctacttacagatcgttttga

DBGET integrated database retrieval system