KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105185767Help
Entry
105185767         CDS       T03918                                 

Definition
(RefSeq) pyrimidodiazepine synthase
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00480  Glutathione metabolism
hst00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:hst00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105185767
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    105185767
Enzymes [BR:hst01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     105185767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C_3 SH3BGR
Motif
Other DBs
NCBI-GeneID: 105185767
NCBI-ProteinID: XP_011143823
UniProt: E2BRF9
LinkDB All DBs
Position
Unknown
AA seq 242 aa AA seqDB search
MNTKHLSTGSVPPPLVPGKIRLYGMRFCPYAQRVLLVLDAKQIPYDVVNINLKHKPDWLI
EKNPLEDVPCIELEGGETLYNSLIIVDYLDEAYPHNKLYPIQPLKKAKDKILIDRFNEVI
TTIYKAYRAPKLEQDLFNEALAKLELFERELAKRGTAFFGGGKPGMLDFMIWPWCERADA
MTILQGEQFVIPRDRFLRLLEWRAAMKEDSAVRGSFLEAEIHAKYIRSSLARAPQYDLVA
NN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaaacacttaagcaccggatcggtacctcctcctcttgtacctgggaaaata
cgtttgtacggcatgcgtttttgtccgtatgcgcaaagagtattgctcgtattggacgca
aaacaaattccgtatgatgttgtgaatataaatttgaagcataaaccagactggttaata
gaaaaaaatccactggaagatgttccatgcattgaactggagggaggagagacattatac
aacagtctaattattgttgattatctggatgaggcttatcctcacaataaactgtatcca
atccagcctttgaaaaaagccaaagataagatattgattgatagatttaatgaggtgata
acaacaatatataaggcgtatcgagcaccaaaactggagcaggatttattcaacgaggca
ttagctaaattggagctctttgagcgagagttagccaagagaggaacagctttctttggt
gggggtaagcctggaatgttggattttatgatatggccatggtgtgaaagagctgatgca
atgacaattctacagggagaacagtttgtcatacctcgagatcgctttctgcggctgctt
gaatggagagctgcgatgaaggaagattctgcagtacgcggcagcttcttagaggctgag
atacatgccaaatatatacgcagttctcttgcacgtgcacctcaatatgatcttgttgct
aacaattaa

DBGET integrated database retrieval system