KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105185960Help
Entry
105185960         CDS       T03918                                 

Definition
(RefSeq) fatty acid synthase-like isoform X2
  KO
K00665  fatty acid synthase, animal type [EC:2.3.1.85]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00061  Fatty acid biosynthesis
hst01100  Metabolic pathways
hst01212  Fatty acid metabolism
Module
hst_M00082  Fatty acid biosynthesis, initiation
hst_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hst00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    105185960
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hst01004]
    105185960
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hst04147]
    105185960
Enzymes [BR:hst01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase system
     105185960
Lipid biosynthesis proteins [BR:hst01004]
 Fatty acid synthase
  Animal type
   105185960
Exosome [BR:hst04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105185960
  Exosomal proteins of breast milk
   105185960
  Exosomal proteins of colorectal cancer cells
   105185960
  Exosomal proteins of bladder cancer cells
   105185960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ketoacyl-synt KR Acyl_transf_1 Ketoacyl-synt_C KAsynt_C_assoc ADH_zinc_N_2 PS-DH ADH_zinc_N Thioesterase PP-binding Thiolase_N adh_short Abhydrolase_6 ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 105185960
NCBI-ProteinID: XP_019698145
LinkDB All DBs
Position
Unknown
AA seq 2397 aa AA seqDB search
MNRDGKTALFESGDEIVISGIAGRFPKSDNIKHLQENLLNNVDLGSDDCQRWQHEHMDVP
RRTGKVNNIEKFDAEYFDMPFNQAHLMDPMCRCLLEHTYEAIVDAGINPKDLRNTKTGVI
VGACYTETERIFFYEKVQVAGLGLLGIKSMLANLISRWLSLKGPSCLIDTACSSSLSAME
RAYRIIRSGECDAMIVAGTNLCLNPFISLQFARLGVLSPDGFCRPFDRDANGYMRSETIA
AVFLQKAKNAKRIYASVVYAKMNCDGFKEQGITFPSSEMQGRLLEEFYNECGVSPSCISY
LEAHGTATKVGDPEEVNAIERVFCKDERSPLLIGSVKSNLGHSEPASGMCQIAKVVIAME
IGIIPPNLHFTKERDDIEAFKTGTVRVVTTPTTWEPTLVGINSFGFGGANTHILLEPNMK
QKVNGGAPKDDLPRLVVLSGRTEQAVESFLREIESQSVDVEYIRLLHDLHAEELLNHPYR
GYTIAENQISSNVTSEIHHYDGVRKPICFVFPGIGSQWLGMGEALLRFPAFSKAVKDCDA
ILRAYGVNIINILTSKMEDTFDSILNSIVGITMMQLGLIDLLTSVNIVPDYVIGNSIGEL
CCGYVTGEFTAEQVILSAYYIGLALSEVKTIQCAKVDIGLDYKSLKAICPADIEIICSYS
PNACSINGPIESVKIFVTKLQDSKVPTKVVACSNIPLHTSYLANATPRISSYLYQTISQK
MTRSQIWRRSPCDYNLSYAEYFTNSLVNPIFFEDVAKMIPENAAFVEIAPDGILQDILNK
IFDTTTITLAQRHHEDNAKVFLQGLGKMYNCGSQPQLANLYPAVEFPVSRGTPMISPSIK
WKHSEDWYVAFYSNEKCITSGERIIRISLSDEDHEYMNGHVIDGRKLVPATGYIFFIWET
VAMLKGQWQSNVPVVFEDIKFLRATHMSSQGNVELTLMVQKASGIFEIIEGNTTIVTGKV
RVPSDPAKERIVTDFLQNDDDEEEVMKTKDVYKELKLRGYQYTGVFRGIKSSSIMGTRGH
IAWLNNWVAFMDNILQMHILGTDTSSLYVPTGIGRMVIDPQLHAQHIQDITNEDKQLAVC
MYKKLDTIVSGGIEINGISATPILRRKPIGHPVLEEYKFVAHRDGDKVPFEDGIILSTHL
ALEYHQMTRVNIIELIEDGDVSEITTKELASPIFVEILSNLPLIQPNINLIARTNSLDCV
ILPPEITISQSKKLSKDDNAILVSGYNLLTSGKNDTLRDILQALKSGGFLLTRGQPLDKE
DIATAESYNLAVVLEKQTEKEHITLLKKRGQSTSKTDVIFANNHEFSWVEQLKLSLSEEN
KLTNTTRIIIVGEGDTECGLLGLVNCLRKEPGGELIRGVFIQDENAPKFSLHDPFYAEQL
RMDLIINVLRPEKVWGSYRHLPLAPLKSKLVHHAFVNQMVHGDLSSFYWIEGPINLNYEH
PRFVNIIYATLNFKDVMTATGKIKMERFMSRGRMEDCMIGLEYVGIDDTGRKIMGLAENK
CISNMQVFDQHLSWEIPDGWTLEDAATIPCAYSTFYYGLSLGRKLRKSDKILIHSGTGAV
GQAAINIALHEGCEVFTTVGTLEKRKFIRDTFPSIPEDHIGNSRDTSFEQMINQQTKGRG
VDVVLNSLAEDKLQASVRCLARNGRFLEIGKFDILSNNTLDMSIFSKGIKFYSIMLDKIF
SSSFIKKSQLNNVLREGLDNGAVKPLIRTIFQKDEVETAFRYMAAGKHIGKIVIKIQEEG
KFMNTPLLALPRYYCLPNRSYIILGGLGGFGLELADWLVVRGARNLVLISRTGLKNGYQR
MKVELWKSYGVKVLIVSNVDASDIKDCEYILRTAEELAPTDAIFNLAVVLNDKICQNHTI
ETFQEPFKAKAWATKNLDQLSRCICPELRHFVVFSSVSCGRGNAGQSNYGMANSIMERIC
ERRTQEGLHGLAIQWGAIGDVGIVADMQEDDKEMVIGGTLQQKISSCIEKLEEFLLQKQP
VVASMVVAEKRSGAVSSISVIDTVANIMGLKDLSTVSAHARLSEIGMDSMMAVEIKQTLE
REYEVFLTAQDIRNLNFAKLAEMFNQETLNEKLRSDNLKDSSDLAGLKLLVRVIGDDNYS
IPDVCISLPTKADTARDEIFLLPGVEGCWSIFNLLAPKIEAPAVCLQYGTYNIGNDCHTI
SEIADCLLKHITDRIKSRKNFVIVAYSFGTIIGIELVRRLEEMSLRGRLVLIDGAPEQMK
ALASQHLPFTTIDELQNNVLLGITDMLQPAVSGKLLLELNKFSNWDDKLNVFMSHIPPTY
RKMSIDYSKATCTTVYKHIQALHKYDVTQIQKIVSSVILLKPTMQSLRVPDEDYGLHKIT
TGRVQIHSVEGNHITILDSDKVVAAINGQQIEGVKKTQSNIIDDKPIISVESNRTRS
NT seq 7194 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcgacgggaaaaccgcactcttcgagtctggagatgaaatcgttatttccggg
atcgcaggcagatttcctaagtctgacaacatcaagcaccttcaagagaatctacttaac
aacgtagatctcggttcggatgactgtcaacgttggcaacacgaacatatggacgtgcca
cgacgcacgggaaaggtcaataatatcgagaaatttgatgcggaatattttgacatgccc
ttcaaccaagcccacctgatggatcctatgtgtagatgcctcttagaacatacgtacgaa
gccatcgtcgatgcaggaataaatccaaaggatttacgtaataccaaaaccggagtgatt
gtcggagcgtgttacactgaaacggagaggattttcttctatgaaaaagtacaggtcgct
ggtcttggattactaggcatcaagagtatgctagcaaatttgatttctcgctggttaagc
ctcaaaggaccgtcttgtcttatcgataccgcctgcagttcaagtctttccgctatggaa
cgcgcttacagaataattcgatctggagagtgcgacgctatgatcgttgctgggacaaat
ctatgcttgaatcctttcatatccttgcagtttgcgcgacttggtgttttatcgcctgac
ggattctgcagacctttcgacagagatgccaatggttacatgcgcagtgaaacaatcgca
gcggttttccttcagaaagcgaagaacgctaaaagaatttacgcatctgtggtgtatgcc
aagatgaattgcgacggattcaaggagcaaggcattactttcccatcgagcgaaatgcaa
ggacgtttacttgaagagttttacaacgaatgcggcgtctcgccgtcttgcattagttat
ctagaagctcacggtaccgctacgaaagtgggcgatccggaagaagttaatgcgatagag
agggttttctgcaaagatgaacgtagtcccctcttgattggttccgtcaagtccaacttg
ggtcactctgagcctgccagtggcatgtgccaaattgctaaggtggtgatagcaatggaa
attggcataatcccaccaaacttacatttcacaaaagaacgagatgatattgaagctttt
aagacagggactgtacgagtcgtgactactccgacaacatgggagcctactttagtgggt
ataaattctttcggttttggcggggccaatactcacattttgttagaacctaatatgaag
caaaaagtcaacggtggggcaccaaaggacgatttgccaagactcgtcgtcctgtccggt
cgtaccgaacaagcagtggagtcattcttacgtgagattgaaagtcaatcggtagatgtt
gaatatattcggttgttgcacgacctccatgcggaagaacttctaaatcatccttacaga
ggttacacgattgctgaaaaccaaatatcgagcaacgtaacaagcgaaatacatcattat
gatggagtaagaaagccaatttgtttcgtgtttcccggcattggatcccaatggcttggc
atgggagaagcattactacgatttccagcattttctaaggctgtaaaagattgtgacgcc
attttaagagcttatggggtaaacatcatcaacattttaacaagtaaaatggaagatacc
ttcgatagcatattaaactcgattgtagggatcaccatgatgcagcttggattaatcgac
ctcttgacttctgtgaatatcgtgccagattatgttatcggtaattcaatcggtgaactc
tgttgtggatacgtgacaggcgaattcacagccgaacaagtgattttatccgcttattac
attggactggcattgagtgaagtaaaaacaattcaatgcgccaaggtggatattggtctg
gactataaaagtctgaaggccatatgcccggcagatatcgaaataatctgcagctatagc
ccgaatgcttgttccataaatggaccgatagagtcagtgaaaatattcgttacaaaatta
caggatagcaaggttcctacaaaggtagttgcttgcagcaatattcctctccatacttct
tatcttgccaatgcaacgccaaggatttcgtcttatttgtaccaaacgatatcgcaaaag
atgactcgcagccagatatggcgcagatcgccttgcgattataacttatcatacgcagaa
tactttaccaacagtttagtgaatcctatatttttcgaagatgtcgcgaaaatgattccg
gagaatgcagcgttcgtggaaattgcgccggatggaattctgcaggacatcttgaataaa
attttcgatacgacaaccatcacgttggctcaacgccatcacgaagataacgctaaagta
tttttgcaaggactcggcaagatgtacaactgtggctcgcagccgcaattagccaatctc
tatccggctgtagaatttccggttagtcgcggcacacctatgatctcgccgtcgatcaaa
tggaaacactccgaggattggtacgtagcgttctactctaacgagaagtgcatcacttcc
ggagaaagaataatcaggatctcattgagcgacgaagatcacgaatatatgaacggtcat
gtaattgatggaaggaaattggtaccagctacaggatatatattttttatttgggaaaca
gttgccatgttaaagggccagtggcaaagtaacgtacctgtcgtgtttgaggatatcaaa
tttctccgggcgacccatatgtccagccagggaaatgtagaattgacgttaatggtgcag
aaagcaagtgggatatttgagataatagaaggtaacaccactatcgttactggcaaggtg
cgtgtaccgtcggatcctgccaaggaaagaattgtgactgatttcttacaaaacgacgat
gacgaagaagaagtgatgaagacaaaagatgtctacaaggaactcaaattacgtggatat
caatatactggcgtgtttcgaggaataaaaagttcatccattatgggcacgcgggggcat
atagcttggttaaataactgggtagctttcatggataatatactgcaaatgcatattctc
ggcacagacacgagtagcctttatgtccctactgggataggcaggatggtaatcgatccg
caacttcacgctcagcacattcaggacataacaaatgaagataaacaacttgctgtgtgt
atgtacaaaaagttggacacaatagtatccggtggtatagagatcaacggtatttcggct
actcctatattacgacggaagccaatcggacatcctgttcttgaagagtacaagttcgta
gctcatcgtgacggagacaaggttcccttcgaagatggaataatcctgtcgacgcatttg
gccctggagtatcatcaaatgacgagagtgaacattatcgagctgatcgaagacggcgac
gtctccgaaataacaaccaaggaattagcgtccccaattttcgtcgaaatcttgagcaat
ttaccactcattcaacccaacatcaacctaatagcgagaaccaacagcctcgattgcgtc
atacttcctccagaaattacaatatcgcagtcgaagaagctgtcaaaggatgacaatgcg
atattagtgtcgggctataatttgttaacgagtggcaagaacgatactttgagggacatc
ttacaggcattgaaatccggcgggtttttgttgacacgaggacagccactcgacaaagaa
gacattgcgactgctgaaagctacaatctagctgtggtacttgaaaaacagacagagaag
gagcatattacacttttgaaaaagagaggccaatcgacgagtaaaacggatgttatattc
gcgaacaatcacgaattttcctgggtggagcaactcaaattaagtctgagcgaggaaaat
aaattgactaacaccacgagaataattatagttggtgaaggggacacagagtgcggctta
ttgggtctcgttaactgtttgaggaaagaaccgggcggtgaattaattagaggagtattc
attcaggacgagaacgcaccgaaattctcattgcacgatcccttctacgcggaacaactt
cgaatggatctcattataaatgtcttacgccccgaaaaagtatggggttcgtacaggcat
cttccgttagcgcctttgaaatctaaacttgttcaccatgccttcgttaatcaaatggtt
catggtgatttaagttcattttactggatcgagggcccgattaatctgaattatgagcat
cctagatttgtcaacataatatacgcgactcttaatttcaaagacgtgatgacagcaacc
ggtaaaattaaaatggaacgttttatgtctcgcggaagaatggaggactgcatgataggt
ttggaatatgttggtatcgacgatactggacgcaaaataatggggctggccgaaaataag
tgcatatcaaacatgcaggtgttcgatcaacatctatcctgggaaattccggacggatgg
actctcgaggacgctgcgacgattccctgcgcttatagcacattttattacggactgtct
cttggtagaaagttaaggaaaagcgacaaaatattgatccattcaggtaccggcgctgta
ggacaagccgctatcaatattgcgcttcacgaaggttgcgaagtatttactactgttggt
accttggaaaaacgaaagttcatacgagatacttttccgtctattccggaggatcatatc
ggaaattcgcgcgacaccagtttcgagcagatgataaatcaacagaccaaaggtcgtggt
gtggatgttgtattaaattcattggccgaagataaacttcaagcgtctgtacgttgcctt
gccagaaatggacgatttttggaaatcggaaaattcgatatactgtctaacaatacattg
gacatgtccattttttcgaaagggatcaaattttacagcattatgttagataaaatattc
agtagttctttcataaaaaaaagccaattaaataatgtattacgtgagggtcttgataac
ggagcagttaagccacttattagaacaattttccaaaaagatgaagtagagacggcgttt
aggtacatggcagcgggtaaacatatcgggaagatagttataaagatacaagaggaggga
aaattcatgaacacgcctttgcttgccttaccgcgttattattgtctaccgaataggtca
tacattatcttgggaggattgggtggtttcggcttggaattagccgactggttagtcgtt
cgtggtgccagaaacctcgtgcttatctcacgaactggactaaagaacggttatcagcgt
atgaaggttgagctgtggaaatcttacggagtaaaagtattaatcgtatcgaacgtcgat
gcgtcagacatcaaagattgcgagtacatattgagaacagcggaggagctggcgccaaca
gacgccatattcaatcttgctgttgtactaaacgacaagatttgtcagaatcacacgata
gagacattccaggaaccattcaaagcgaaagcgtgggccacgaagaacttggaccagttg
tccagatgcatatgtcctgagctacgtcacttcgtcgtcttctcctccgtgtcgtgcggt
agaggcaatgccgggcagagcaattacggaatggcaaattctatcatggaaagaatctgc
gagagaagaacacaggagggcttacacggattggcgattcaatggggcgccatcggcgat
gtcggtattgtggccgacatgcaagaggacgataaagaaatggtcattggcggtacattg
cagcaaaaaataagttcctgcatcgagaagctggaagaatttctcttacaaaagcagcca
gtagtggcgagcatggttgtggcagagaagcgttcgggcgctgttagctccatcagtgtc
attgacaccgtagccaacattatgggtttgaaagatttgagtactgtgtccgctcatgca
cgcttgtctgagattgggatggactcaatgatggccgtggaaatcaagcagaccttagaa
cgagagtatgaagtctttctcactgcccaggatattcggaacctgaacttcgccaaactt
gccgaaatgtttaatcaagaaacgctgaatgagaaactgcgttccgataatcttaaagat
tccagtgacttggctggtctaaaattactcgtccgagtgataggcgatgataattactca
atacccgacgtttgtataagtcttccgacgaaagctgatacagcgagagacgagatattt
ctgttgccgggagtggaaggttgctggagtattttcaacttattggcgccaaaaatagaa
gctccagctgtatgcttacagtacggaacgtataatattggcaacgactgtcacacgata
agcgaaattgctgattgtcttttaaaacatataacagacagaatcaagtcgagaaagaac
ttcgtcatagtcgcgtattcatttggaacaatcataggaattgaattagtaagaaggttg
gaagaaatgagcctgcgaggcagattagtacttattgacggcgcacctgagcagatgaaa
gcattggcgagtcagcatctacctttcactacgattgatgaacttcaaaataatgttcta
ctgggtataacggacatgttacaacctgctgtcagtggaaagcttctgttggaattaaat
aaattttctaactgggatgataagttgaatgtgtttatgagccatattccgccaacatat
aggaaaatgtcaatcgactattcaaaagctacatgtacaactgtatacaaacatattcaa
gctcttcataagtatgatgtgacacaaatacagaagattgtgtcatccgtaatacttcta
aaaccaaccatgcaatcgttgcgtgtgcccgatgaagattatggtctacataagattact
acaggaagagtgcaaattcattctgtagaaggtaatcacattacgatccttgacagcgat
aaagtagtagctgcgatcaatgggcaacagattgaaggtgtcaaaaaaacacagtcaaat
ataatagacgataaaccaataatctctgttgaaagtaaccgtactagatcataa

DBGET integrated database retrieval system