KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105186058
Entry
105186058         CDS       T03918                                 

Definition
(RefSeq) uncharacterized protein LOC105186058
  KO
K16678  eiger
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst04013  MAPK signaling pathway - fly
hst04214  Apoptosis - fly
hst04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:hst00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    105186058
   04391 Hippo signaling pathway - fly
    105186058
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    105186058
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 105186058
NCBI-ProteinID: XP_011144302
LinkDB
Position
Unknown
AA seq 589 aa
MTSMLPEENSNSIKMKQKLLNDRPVKEETRSFLSFSRENLSISHSDLEQGFNRSRLRPTR
NTILSVAAIVIALLCLTILSWKLRCLTANMHEIDQLKRDVEELKHRFLKQNLMNDLKAFE
EQLYGEKSSEDDDPGEADIDYADYDTNYDDDSSTSHDYSGELPGNQHVPLIYGSRPSDFP
EITSTPAPTSPKPHTNPFLILMEFLSTAETKRGQELEKNMRENHKNIEQKRFKEEHRIRV
SHEEKSGDTNSTKHKHDVFTSSTEYSKPAPQQQDKNVKRKRSVKEYMVTDHSTDTSNYEL
NDQHHSITSKVHSHVNDGNRTNNNSGTNLAASTVSWDVHPPKKYHAHARLDTSSSVDDER
LSEEITHQRSSRERMGHVRGRRTNWRKMEHRGAMKNKTGSEILEAAQNYEVAATEPPRKL
TRRHLRAPRQVYAIHYEADFNLFSTLDEKDDNGKVRHHRGIFKAWRPSDWVTELGMNRHF
TLSSEGEITVHETGLYLAYAQIHYVDEHDDNGFHLLVNGEPILQCMVHTPGIGHKSRSCF
SARVTFLQADDRLVLKEVGAAKFALFHREKSFLGLAKLGEMRPQQKHQM
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgacgtcgatgctaccggaagaaaatagcaactcaatcaaaatgaagcaaaaattgctg
aatgacagacccgtgaaagaagaaacgaggtccttcttgagtttctcgcgcgaaaactta
agcatctcacactccgacttagagcaaggatttaacaggtcgcgactaaggccgaccagg
aatacaatcctgagtgtggccgccatcgtgatcgctctcctttgccttaccattttaagt
tggaaattgcgatgtttgacggcaaacatgcacgaaatcgaccagctaaagagagacgtc
gaagagctgaagcatcgctttctgaagcagaatcttatgaacgatctgaaagcgttcgag
gaacagttatacggcgagaaatcgagcgaagatgatgatccgggcgaggcagacattgat
tatgcggattatgacaccaattacgatgacgatagttctacatcgcatgactattccggt
gaattacccggaaatcagcatgttcccttgatttatggatccagaccatcggacttccct
gaaattacatccacgccagcacctacgtccccgaaacctcacactaatcctttcctaata
ttaatggagttcttgagcacagctgaaacgaaacgtggacaggaattggagaagaatatg
cgagaaaatcacaaaaacattgagcagaaacgttttaaggaggaacacaggatacgagtg
agtcatgaggagaagagcggtgacacgaacagcaccaaacataaacatgatgtcttcacc
tcgagcacagaatattcgaagcctgctcctcaacagcaggacaaaaatgtcaagcggaag
cgttcggtgaaagaatatatggttaccgatcattcaacagatacatcgaattacgagctc
aacgaccagcatcacagcatcacgtcgaaagtacactctcacgtgaacgacggaaatagg
acgaataacaattctggaacgaatttagcagcgtcgaccgtttcttgggacgtacatccc
ccgaagaagtatcacgcccacgcacgtctagatacgtcttcttcagtggacgatgagcga
ttaagcgaagaaattacgcatcaacgcagcagcagagagagaatgggccatgtgcgtggt
agaagaaccaactggcggaaaatggagcatcgtggtgccatgaagaacaaaacgggaagc
gagattctcgaggccgctcagaattacgaagtggctgcgacggaacctcctcggaaattg
accaggcggcatttacgcgcgccacggcaggtctacgcgattcattacgaggcggacttc
aatctcttttcaacgttggacgagaaggacgacaatggtaaagtacggcaccacagaggc
atcttcaaggcatggcggccgagcgactgggttaccgaactcggcatgaatcgccacttc
acactctccagtgaaggtgaaattactgtgcacgagacgggattgtatctggcatacgca
caaattcattacgtggacgaacacgatgataacggcttccacttattggtgaacggcgaa
cctatcctacaatgcatggtacatacgccaggtatagggcacaaaagccgctcatgtttc
tccgctcgagtgacctttctccaagcagatgatcgtctagtcttgaaagaagttggagca
gccaaattcgcactttttcatcgcgaaaaaagcttcttaggcttagcaaaacttggtgag
atgagaccgcagcaaaagcatcaaatgtaa

DBGET integrated database retrieval system