KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105186723Help
Entry
105186723         CDS       T03918                                 

Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 3 isoform X1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00071  Fatty acid degradation
hst00410  beta-Alanine metabolism
hst00592  alpha-Linolenic acid metabolism
hst00640  Propanoate metabolism
hst01040  Biosynthesis of unsaturated fatty acids
hst01100  Metabolic pathways
hst01200  Carbon metabolism
hst01212  Fatty acid metabolism
hst04146  Peroxisome
Module
hst_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
hst_M00087  beta-Oxidation
hst_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:hst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    105186723
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105186723
   00592 alpha-Linolenic acid metabolism
    105186723
   01040 Biosynthesis of unsaturated fatty acids
    105186723
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105186723
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105186723
Enzymes [BR:hst01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     105186723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 105186723
NCBI-ProteinID: XP_011145417
LinkDB All DBs
Position
Unknown
AA seq 710 aa AA seqDB search
MNKLMCYVCVRTGLYKYMPFLGGRRFSSTMKTSIVDSLISDLPKGPLDAYRKRATFDWKS
FKLALNGEDYLRYEDDLWKLVKTNPAFQRLPGSATLDEIQRHCNAGVRAINEAEIFPWNN
QNELYVLCQYDPSVIIKLGVSRGMVPNSILALGTDQHYHLIEKFEDGSYIGCFALTEISH
GTNAKGIRTTATYDVATKSFIFHTPDFEAAKCWVGGLGKTATHAVLFARLITPDGVNHGL
HPFIVQIRDLETHLPMPGVTVGNMGEKIGLNGIDNGFVMFNKYFVLRNCLLNRTADVTED
GKYLTTVKSESKRFGSSLGALSGGRIAITNICAEYMSLAIVIALRYCAVRRQFGPTEDNE
LPVIEYQTQQWRLLPHLAATYAIKLFSKDFFIKLIEFNLSRFTDENIDPDLIANMGMEIH
ALSSATKPFCSWTARDAIQDCRESCGGHGYLKMSRLGEIRANNDANCTYEGENNILVQQA
SNWLLNQWDNAIKGRLVPSPFGFIDFLPVAEQIFSIKFDRKTIDDTVEPKYLLLISKWLV
CYYLKKTYQHVKQLKSSGMSDFDVKNNSQTFLARTLSLVYAEHAVLSYFCKNLQDPKWSL
NERQVLTDLCSLFGAVLLEKRLGDLYAGGFASPDSNIDNLLREGIIKLCKKLVDNAVALV
DVLAPPDFVLNSPLGMSDGEVYKHMKEWIYSEKENLQRPSWWTEIVKSKL
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgaataaactgatgtgttacgtttgcgttagaaccggtttatataaatatatgcctttt
ttaggaggaagacgtttttcaagcacaatgaagacatcaattgtcgatagtttgataagt
gacttgccaaaaggaccattagatgcttatagaaaacgtgcaacatttgactggaaatca
ttcaaattggctttaaatggagaagattatctacgatacgaggatgacttatggaagcta
gtgaaaactaatccagcatttcaaaggttgccagggtcagcaacattagatgagattcaa
agacactgtaatgctggagtgagagcaattaatgaggctgagatttttccatggaataat
caaaatgagctatatgtcttatgccaatatgatccatctgtaattataaaactaggggtc
tcaagaggtatggttccgaatagtatacttgcactgggtactgatcaacattatcatttg
atagaaaaatttgaagatggaagttatattggctgttttgccttgactgaaatttcccat
ggtaccaatgcaaaaggcataaggactacagcaacatatgatgtagcaacaaaaagtttc
atttttcacacaccagattttgaagctgcaaaatgttgggttggtggcttagggaaaact
gcgacacatgctgttttatttgcacggttaattacaccggatggggtaaatcatggtctg
catcctttcatcgtacagattcgcgatttagagactcatctgcccatgccaggtgttact
gttggtaacatgggtgaaaagataggactaaatggaatagacaacggatttgtaatgttt
aacaaatattttgtactacgtaattgtttgttaaatcgtacagcggatgttactgaagat
ggaaaatatttgaccactgtaaaaagcgagagcaaaagattcggttcatcgttaggtgca
ttatcaggaggtcgtatcgctattactaacatatgcgcagaatatatgagtctcgcaata
gtgatcgcattacgttactgtgctgtgagaagacaatttggcccaacagaggacaatgaa
ttgccagttatagaatatcaaacgcaacaatggagattattgcctcacttagctgcgaca
tacgcaataaaactgttttccaaagatttctttataaagctaatagaatttaacttaagt
cgctttacggatgaaaacattgatccagacttgattgcaaatatgggaatggagatacat
gcattgtcttccgcaactaaaccattttgctcatggacagctcgcgatgcaattcaggat
tgcagagagtcttgcggtggccatggatatttgaaaatgtcgcgcttgggtgaaataaga
gcaaataacgatgcgaactgcacatacgaaggtgaaaacaatatactcgtacaacaagca
agtaactggctcttaaaccaatgggataatgcaattaaaggacgtcttgtaccatctcca
tttggtttcatagactttcttcctgttgcggaacagatattcagtatcaaatttgacaga
aagacaatagatgacacagtagagcctaaatatttgcttctaatttctaaatggttggtg
tgttattatttgaagaagacgtaccaacatgtgaagcaacttaaatcgagcggaatgtct
gattttgatgtaaaaaataattcccaaacattcctagcgcggaccttatctctcgtgtat
gcggagcacgctgtattatcatatttctgcaaaaatttgcaagatccaaaatggagcttg
aacgaacgacaagtgttgactgatttgtgttctctgttcggagctgtacttttggagaag
agactgggagatttgtatgctggcggtttcgcatctcctgattctaatatcgacaacctt
ttacgagaaggaattataaaactctgtaagaaattagttgacaatgcagttgcgctggtc
gatgtcttggcaccgcctgattttgtacttaactcacctctgggaatgtctgatggagag
gtatataaacatatgaaggaatggatatatagcgagaaagagaacctgcagcgtccgtcg
tggtggactgaaattgtgaagtctaaattataa

DBGET integrated database retrieval system