KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105186948
Entry
105186948         CDS       T03918                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X1
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:hst00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    105186948
SSDB
Motif
Pfam: CDI BORA_N
Other DBs
NCBI-GeneID: 105186948
NCBI-ProteinID: XP_011145785
LinkDB
Position
Unknown
AA seq 151 aa
MPYRRSTTFAADGMRDTPGEARLTMEERNVDQQEEVIRRNLRRRLFQDDEDDDSGQSTNS
ESGDGQTSNGENDNLANRLFEEARRNRENAKKRWNFDFENEVPLPGRYEWVRVDRDGNEI
SDFAQLKNGLRDSQEERPEGAAEEADAEEKE
NT seq 456 nt   +upstreamnt  +downstreamnt
atgccttatcgtcgttcgacaacattcgcggcagacggaatgagggacaccccgggagag
gctcgcctgacgatggaagaaaggaacgtcgaccagcaggaagaggttatacgtcgaaac
ctgcgcaggagacttttccaggacgacgaggatgatgacagcggacaatcgacaaacagt
gagagcggcgacgggcaaacgagcaatggcgagaacgataaccttgccaatcgtctgttc
gaggaagctcgacggaatcgagagaatgcgaagaaaaggtggaacttcgatttcgagaac
gaagtgccgctgcctggtcgttacgaatgggtgagggtcgaccgtgacggaaatgaaatc
tctgatttcgcgcagttaaaaaacggactacgtgattcgcaagaggaacgcccggagggg
gcagcggaagaagcggatgcggaagaaaaggaatga

DBGET integrated database retrieval system