KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105187019
Entry
105187019         CDS       T03918                                 

Definition
(RefSeq) serine/threonine-protein kinase 3 isoform X1
  KO
K04412  serine/threonine kinase 3
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst04214  Apoptosis - fly
hst04391  Hippo signaling pathway - fly
hst04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hst00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04391 Hippo signaling pathway - fly
    105187019
   04392 Hippo signaling pathway - multiple species
    105187019
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    105187019
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hst01001]
    105187019
Protein kinases [BR:hst01001]
 Serine/threonine kinases: STE group
  STE20 family
   105187019
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Mst1_SARAH ABC1 Pkinase_fungal bZIP_1 DUF1192 Phage_Mu_Gam Abi_2 Nore1-SARAH
Other DBs
NCBI-GeneID: 105187019
NCBI-ProteinID: XP_011145884
LinkDB
Position
Unknown
AA seq 527 aa
MSSKSELKKLSEESLTRQPEEVFDIICKLGEGSYGSVYKALHKESGQVLAIKQVPVDTDL
QEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIMRLRKKTLQEDEIA
TILSDTLKGLEYLHLRRKIHRDIKAGNILLNNEGHAKLADFGVAGQLTDTMAKRNTVIGT
PFWMAPEVIQEIGYDCVADIWSLGITALEMAEGKPPYGDIHPMRAIFMIPTKPPPSFREP
DQWSPEFIDFVSGCLVKNPEERATATELLHHEFIGNAKQPSILNQMIAEAHEIREKQSAH
RAVINNVAIKSQNQADDSDEDDCSGTMKPLPEDSRTLVPSHDLPDTGTLVSAMLDLGTMV
INSDTDTEATMKRHNTGSVESGKKYRPLFLDHFDKKEAPEIGKGNGQILGAHNAENANKL
ELQSPTESQRFQSHLQLQLNQISHPVPEQPHNNISKFQNVFTERDFDFINNHVLQLKFLS
YEELQQRMASLDAEMEREIDELRKRYQTKRQPILDAMDTKRKRQQNF
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgtcttcgaagagtgaattaaaaaagctatcagaggaaagtctgacgagacaacctgag
gaagtgttcgacattatatgcaaactaggggaaggttcttatggatcggtttacaaagct
ttgcataaggaaagtggacaagtgcttgctattaaacaagtaccagtggatacggatttg
caagagatcattaaggaaatctcaattatgcaacaatgtgactctccttatgttgttaaa
tattatggaagttactttaagaatacagatttatggattgtaatggaatattgtggagca
gggtctgttagcgatataatgaggttaaggaagaaaactctgcaagaggatgagattgca
acaatcctgagcgataccctgaaaggactggagtacttgcacttgagaaggaaaatccac
agggatatcaaggctggaaatattctcctgaacaatgaaggccacgcaaaactggcagat
tttggtgtggctggtcaattaacggataccatggctaaacgcaacacagttatcggtacg
ccattctggatggcaccagaagtgatacaagagattggttacgattgcgtcgccgatata
tggtcactcggtatcacagccttggaaatggctgagggcaagccaccatacggcgacata
catccgatgagggcgatatttatgatcccgactaaaccgccgcctagttttagagaacct
gatcagtggagtccagaattcatcgactttgtcagtgggtgccttgtaaaaaatccggaa
gagagagctaccgcgaccgaacttttacaccacgaattcataggtaacgctaagcagccg
agtatcctgaatcaaatgatcgctgaggctcatgagatacgagagaagcaaagtgcgcat
agagctgttataaacaacgtggcgattaaaagtcaaaaccaggcagatgattcggatgag
gacgattgcagtggaacgatgaagccgctaccggaggacagtagaactctagtgccaagt
cacgatcttccagacacgggtactttagtttcggccatgttggacttgggtacgatggtc
atcaatagcgacaccgataccgaagctaccatgaagagacacaatactggctctgtggaa
tccggcaagaaatatcgacccttattcttagatcattttgataagaaagaagcaccagaa
atcggcaagggcaatggacagatattgggagcgcataatgcagagaacgcgaacaaattg
gagctgcaaagtcccaccgaatctcaaagatttcagagtcatctgcaactacagttaaat
cagatatcccatcctgtgccggagcaacctcacaacaacatatccaagttccaaaacgtc
ttcacggaacgtgacttcgattttataaacaaccatgtcctgcagctgaagtttctctcc
tacgaggaactgcagcaacggatggctagtctggacgcggagatggagcgggagatcgac
gagctgagaaaaaggtatcagacaaagagacagcctattctcgatgccatggacaccaaa
cggaagcgccagcagaacttctaa

DBGET integrated database retrieval system