KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105187836Help
Entry
105187836         CDS       T03918                                 

Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Brite
KEGG Orthology (KO) [BR:hst00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hst01002]
    105187836
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hst04147]
    105187836
   04090 CD molecules [BR:hst04090]
    105187836
Enzymes [BR:hst01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     105187836
Peptidases [BR:hst01002]
 Metallo Peptidases
  Family M2
   105187836
Exosome [BR:hst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105187836
CD molecules [BR:hst04090]
 Proteins
  105187836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 105187836
NCBI-ProteinID: XP_011147189
LinkDB All DBs
Position
Unknown
AA seq 663 aa AA seqDB search
MNLQRRRMKAVGICVFIVFFIILLQGEAHGKYLEGLNVNLGDALLFLREYDSAASLMCTR
VMTAQWNFATNITDANHQKMVDEQTLKLKFERASWRKAVTFAWSRIPDPLARRELKMIAT
KGRSSLTDDKFNEIHRLMTEMKEIYIKAKICPYKYVDSNCNLSLDHDINKLMAQSTNYDE
LLYYWHAWHEAVGPKLKNKYLRYVQLANRAAQLNGFADAGDQMKELFEDEYFQQNIAKVM
SAITPLYKNLFTYVRSKLIERYGDKIREDGPLPAHILGNMWAQNWENLFELVQPFPASRK
LDVTLEMMIQGITPLRMFQIAEEFFTSLGMKPMPPEFWKFSMFEKPIDRDVKCSPSAWDF
CNKIDYRIKQCTRATLEDLLSTHYEMAHLQYYLQYKDHPLLFRNEAIPGFREAVSDAIGL
SIFTPQHLHKIGFHSNLTNDYDSNINFLMLMALRKVAYMPFAYIVDQWRWRVFSDGVEDM
TAHWWELRLQYQGIVPPVPRSERNFDPAAKYHIPADSPYAKYFVGVALQFQLFQSLCEIS
GHIGELHTCDLYRSREAGRLLSDVLSMGASRPWQDVVRQMTRGRTNRIDAGAMLKYFEPL
NAWLKRQNEMQPVIGWIASHDDRVGIFHFVSALLSQWYQNGAQRLELCSLFSLLFVVGKV
FIY
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgcagcgacggagaatgaaggcagtgggaatttgtgtcttcatcgttttcttc
attattctgttgcaaggagaagcacatgggaaatatttagagggtctcaacgtgaattta
ggagatgcccttttattcctcagagaatatgacagcgcagcttcgttaatgtgcacgagg
gtaatgacggcccagtggaatttcgcgacaaatattactgacgcgaaccatcagaaaatg
gtggatgagcaaacattgaaattaaagttcgagagagcttcttggcggaaggcagttact
tttgcctggagtcgaataccagatcctttagcaagaagggaacttaaaatgattgccacg
aagggtcgaagttccttgactgacgataaatttaacgagatacatcgcttaatgaccgag
atgaaggaaatctatattaaagccaaaatatgtccatacaaatatgttgattctaactgc
aatttgagtctagatcacgatatcaataagctgatggcgcagtcaacaaactacgacgaa
ttattgtattattggcatgcttggcatgaagcggtcgggccgaaacttaaaaataaatat
ctgagatacgttcaactggccaatcgagcagcgcaattaaatggtttcgctgacgctggg
gatcagatgaaggaattattcgaagatgagtattttcagcaaaacatagcgaaggtgatg
tcagccataacaccgctctataagaatctctttacttacgtgcgatcgaaactgatcgag
agatacggtgacaaaatacgcgaggatgggcctttaccagcgcatattttgggaaatatg
tgggcccaaaattgggaaaacctgttcgagttggtgcaacctttccctgcaagcaggaag
ctcgatgtgaccttggaaatgatgatccagggcatcactccactgaggatgtttcaaata
gccgaggagttcttcacttcactcggaatgaagccaatgccgccagaattctggaaattc
tccatgttcgagaaacctattgatagggacgttaaatgtagtcccagcgcgtgggacttt
tgcaataaaatcgattacaggataaagcaatgtacccgagctacattagaagatctactg
tcgacgcattacgaaatggcacacttgcaatattatttgcaatacaaagaccatccgtta
ctatttcgaaatgaagcgatccctggtttccgcgaagctgttagcgatgcaattggttta
tccatttttactcctcaacatttacacaaaatcgggtttcacagtaatttaacgaatgat
tatgacagtaacataaattttctaatgttaatggctctccgtaaggtagcttatatgccg
tttgcttacatagttgaccagtggaggtggcgtgtctttagcgatggtgtggaagatatg
acagcacactggtgggaattgagactgcagtatcagggtattgttccaccagtgcctaga
tccgaaagaaatttcgatccagctgcaaagtatcatatcccagcggacagtccttatgct
aagtattttgtaggcgttgctctacagttccaactgttccagtcattgtgcgaaatctct
ggtcacattggcgagttgcacacttgcgatctttacaggtcacgagaagcaggtcgatta
ttatcggacgttctgtcgatgggagcttcgagaccatggcaggatgttgtcaggcagatg
acgagaggtaggacgaataggatagatgctggtgccatgctcaaatattttgagcctttg
aatgcgtggttaaaacgacagaatgagatgcagcctgtgatcggttggattgcaagtcac
gacgatagagtaggaatctttcattttgtttcagcactgttatctcaatggtaccaaaat
ggtgcgcagcgactagaattgtgcagtctattttctctgctgtttgtagttggcaaagtt
tttatttattaa

DBGET integrated database retrieval system