KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105188133Help
Entry
105188133         CDS       T03918                                 

Definition
(RefSeq) arginine kinase
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00330  Arginine and proline metabolism
hst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hst00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    105188133
Enzymes [BR:hst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     105188133
Exosome [BR:hst04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   105188133
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 105188133
NCBI-ProteinID: XP_011147732
LinkDB All DBs
Position
Un
AA seq 374 aa AA seqDB search
MGGCTSKDTTSGDDKKSNNMVDAAVLDKLESGFAKLAESDSKSLLKKHLTKEIFDQLKTR
KTSFGSTLLDVIQSGLENHDSGVGIYAPDAEAYTIFAELFDPIIDDYHGGFKKTDKHPPK
DFGDVDSFGNLDPTGEYIVSTRVRCGRSLDGYPFNPCLTEAQYKEMEEKVSSTLSGLGGE
LKGTFYPLTGMSKEVQQKLIDDHFLFKEGDRFLQTANACRFWPTGRGIFHNDDKTFLVWC
NEEDHLRIISMQMGGDLGQVYRRLVTAVNEIEKRLPFSHNDRFGFLTFCPTNLGTTVRAS
VHIKVPKLAANKAKLEEVAAKYNLQVRGTRGEHTEAEGGIYDISNKRRLGLTEYQAVKEM
NDGIAELIKLEASL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggcggatgtacttcgaaggataccacgtcgggcgacgataaaaagagcaacaatatg
gtggacgcagctgttttggacaaactggagtctggcttcgccaagctggctgaatccgac
agcaagtcgctgttgaagaaacatctgacgaaggagatatttgatcagctgaagacacgc
aagacgtcgttcggctccacgttgcttgacgtgatccagtccggcctggagaaccacgac
tccggcgtgggcatttacgcacccgacgccgaggcttacacaatctttgctgaacttttc
gacccgattatcgatgactaccacggcggctttaaaaaaaccgacaagcatccgcccaag
gacttcggcgacgttgactccttcggcaaccttgatcctactggcgaatatatcgtctcg
actcgagtaagatgcggccgctctttagacggatatccgttcaacccatgtctgaccgag
gcgcagtacaaggagatggaagagaaggtatccagcacgctgtccggcttgggcggcgag
ctgaagggtaccttttacccactcaccggcatgagcaaggaagtacagcaaaagctgatt
gacgaccacttcctcttcaaggagggtgatcgtttcctgcagactgccaatgcctgccgc
ttctggccaaccgggcgcggaattttccacaacgacgacaagaccttcttggtgtggtgc
aacgaagaggatcatctccgtatcatctccatgcagatgggcggtgatctcggtcaggta
taccgtcgtctggtgactgccgtgaacgagatagagaaacggctgccattttcccacaac
gatcgcttcggcttcctcacgttctgcccgacgaatttgggcacgacagtccgtgcatcc
gtgcacatcaaagtgccgaagctcgctgccaacaaggccaagctcgaagaggtcgcggcc
aagtacaatctccaggtgcgcggcactcgcggtgagcacactgaggccgagggcggaatc
tacgacatctccaacaagcggcgcctcggtctcaccgagtaccaggctgtgaaagagatg
aacgacggtatcgctgagctcatcaagctcgaggccagcctctaa

DBGET integrated database retrieval system