KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105188515Help
Entry
105188515         CDS       T03918                                 

Definition
(RefSeq) glycosyltransferase 25 family member
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00310  Lysine degradation
hst00514  Other types of O-glycan biosynthesis
hst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hst00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    105188515
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    105188515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hst01003]
    105188515
Enzymes [BR:hst01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     105188515
Glycosyltransferases [BR:hst01003]
 O-Glycan biosynthesis
  O-linked Gal type
   105188515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1 Glycos_transf_2
Motif
Other DBs
NCBI-GeneID: 105188515
NCBI-ProteinID: XP_011148333
LinkDB All DBs
Position
Unknown
AA seq 570 aa AA seqDB search
MYVMAIFRGCFFVLSVIGVVCVAMYNGISKEPTVLITILVRNKAHTLPYFLSLMEQLDYP
KERMCLWICSDNNVDNTIEILNKWINSEGKKYHCLNVHLNATSMGFEDEKTITDWSSRRF
AHVINLREQALNYARQIWTDFIWMLDADVFLTNSSTLRNLVLKGETVVAPLLKSDGMYSN
FWAGMTAEYYYARTDQYEPILYREEIGCHNVPMIHSAVLIDLRRYESDHLTYKAEKLISY
DGPVDDIITFAIGANKSDVPLFVCNDEIYGFVMVPLEKDETIAEDMQRLINTKVEMLAHS
DYLPLSEDLKQYVTYPEKDTFNLDYIYMINLLRRPERRRRMQKLFKELGIQAEIIDAVDG
RTLNESTLKEWGVKPMPEYADPYHKRPMTTGEIGCFLSHYVIWQKVLEHGYKDVMVLEDD
VRFEPFFRQKVRYVLTELSDLDIKWDLVYLGRKRLMESAESRIQGSKFLVRATYSYWTLG
YILSNSGARKLVDAMPLGKLVPVDEYLPILSDAHPKKQWAAQFPIRDLIILSTNPLLIHP
THYTGENGYISDTEDSKIVRDNESQTREEL
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtcatggcaatctttcgaggttgttttttcgttctttctgttatcggcgtagta
tgtgtagctatgtacaacgggatctcgaaggagccaactgtgctcattacgattctagtc
aggaataaagcacacacgttgccatactttctaagtctcatggagcagctggattatcct
aaggaacgaatgtgcctttggatatgcagcgacaacaatgtggacaatactatagagata
ctaaataaatggatcaattcggaaggcaagaagtatcattgcctgaatgttcatttaaac
gcaacatcgatggggttcgaagatgagaagacgatcaccgattggtcatcccgtagattc
gcacatgtaataaatttgcgcgaacaagcacttaattacgctagacaaatatggaccgat
ttcatttggatgctggatgccgacgtttttttaaccaattcaagcactttacgaaacttg
gttttgaaaggagaaactgttgtagcacctttattgaaatcagacggcatgtatagtaat
ttttgggctggcatgacagcggaatattattacgcacgcacagatcagtacgaaccgatt
ttgtatcgcgaggagatcggctgtcacaatgtgcccatgatccatagtgcagttcttata
gatttgagaagatacgaatccgatcatttgacctataaggctgaaaaactgatcagctac
gatggacccgtagacgatattataacattcgctataggagcgaataaatcggatgtgcca
ttatttgtatgtaacgacgaaatttatggttttgtcatggtacccctggagaaagatgag
actatcgcggaggatatgcaacggttgattaacacgaaggtagaaatgttggcccacagc
gactatttgccactgtcagaagatctgaaacaatatgtaacatatccggaaaaggacacc
ttcaatctggattacatttacatgataaatctgttgagaagaccggagagacgtagaagg
atgcaaaaacttttcaaggaattgggcattcaagcggagattattgacgccgtggatggt
aggactttgaacgagagcaccctgaaggaatggggcgtgaaaccgatgccggaatatgcg
gatccttaccacaagaggccgatgacgacgggcgagattggctgtttcctcagtcattat
gtcatatggcaaaaggtgttggaacatggttacaaagacgtcatggtgctggaggatgat
gtccgcttcgagccgtttttccgacagaaggtccgctacgtcttgaccgagttgtccgat
ctcgatatcaagtgggatttagtatatttgggtagaaagagactgatggagtcggcggag
agccgaatacaaggctccaagttcctcgtgcgagcgacatacagttattggacacttggc
tacattctgtcgaacagcggggcgagaaaacttgtcgacgctatgcctctcgggaaatta
gttcctgttgacgagtatctccctatactttcggatgcgcaccccaagaagcagtgggcg
gcgcagttccccattcgggacttgattatattatcgacgaatccacttctgatacatccg
acgcattacaccggcgagaatggatacatcagcgacacggaggactccaagatcgtgcga
gacaacgagtcgcaaactcgagaagaactatga

DBGET integrated database retrieval system