KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105189653
Entry
105189653         CDS       T03918                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00230  Purine metabolism
hst01100  Metabolic pathways
hst04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hst00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105189653
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105189653
Enzymes [BR:hst01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     105189653
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF2258 RINT1_TIP1
Other DBs
NCBI-GeneID: 105189653
NCBI-ProteinID: XP_011150210
UniProt: E2C3S7
LinkDB
Position
Unknown
AA seq 1021 aa
MCGDGARLEDDEDRYTGVMPQRPDTCNEDSYLRSGRPSSLFRTSFSCARLETLYRASSLQ
QRRGGLQCFLMSAILYAVYTVASPDPGLPSRSITAVFLGLNLGLLAWAKHGARKKDTQSA
WTWKAVPYFVWQLCTAELLLQLFVKNTDITPRDGLGWLLLFLYLLFATLPLRLSHCVLLA
CVTALTYIFVVVCLSKRPDQIPYDILILTVTLSAGAAILGASSYCLAEFQQRREFLETRQ
SLEAQLMFEEQSAEQERLLLSVLPEHVAVKMRQDLGASLDTQFKKIYMSRHENVSILYAD
IVGFTAISSTYSASELVKILNELFARFDQLSERYEQLRIKILGDCYYCISGAPVERPDHA
VLCVYMGLSMVEAIKYVQQTTNSPVDMRVGIHTGAVLAGVLGQRQWQFDVYSKDVELANK
MESSGMAGRVHISNATLSFLNGEFEVEPAHGEHREEALQKAGLVTYFIVRALKPFKPAVT
KSLASLVDAENSRKTMENAPDSGNNKEDSEEFRQQLRKKLDRGGGTDLKCHSSWLTLRFK
DPKVETAFHSAEEAFSPLSLFGGPLITLCAAPVWRFQPWGPFTWGGAGVVALFGLVLAGA
TCLGSAVRATWLRKTLAILMAFSLIEFLLLDMSNCAIITDVEPPSNSSVNWPTLRCPYPS
YYSYIGVLALVAVSMPTYLCYLYKAFLMYILAGGQCCYNILFLAPTIDREDVMSSPHGKE
PRFPLKYSLSAVLLIIATALVIVARYAEKARRMLYLRGREVIAQKERAADMKRRNGVLIY
NILPPHVAVHFLSSARHHDDLYSQSYAEVGVLFASIPNFADFYTEETINNQGLECLRFLN
EVISDFDAILDQNKFKDTIIKIKTIGSTYMAASGITESVETEDGPRWGHLSTLVEFALEL
KKALSGINEQSFNHFVLKMGINHGPVTAGVIGARKPHYDIWGNTVNVASRMESTGKVGCI
QVTDETRRILEPFGFGFEQRGLVDVKGKGQLLTHYLISKDGVSLDLDSDLPVEPTHPIIY
Q
NT seq 3066 nt   +upstreamnt  +downstreamnt
atgtgcggagacggtgcgcgtttagaggacgatgaggaccgttacaccggcgtgatgccg
caacggccagacacctgcaacgaggactcctacctgagatcgggcaggccgtctagttta
ttccggacaagtttcagctgtgcacgactcgagacgctctaccgtgcctcctcgctccaa
caacgtcgcggcggcctccagtgcttcctgatgtcggcgattctctacgccgtctacacg
gtggcgtctcccgacccggggttaccgtcgcgcagcatcaccgcggtgttcctcggcctg
aacctcggcctgcttgcctgggccaagcacggcgcgaggaagaaggacacgcagtcagcg
tggacgtggaaggcggtgccgtacttcgtgtggcagctgtgcaccgcggagctgctcctt
cagctgttcgtcaagaacaccgacatcacgccgagagacggcctaggctggctgctgctg
ttcctctacctgctgttcgccactctaccactcaggctgtcccactgcgtgttgctcgcg
tgcgtcaccgcgctcacgtatatcttcgtcgtagtctgcctctccaagagaccggatcag
ataccctacgatattctgatcctgacggtgacactctcggccggcgccgctattttgggt
gcttccagctactgcctggcagagttccagcagcgtcgggagttcctggagaccagacag
agtctggaggcgcagctaatgttcgaggaacagagcgcggagcaggaacgactgctgctc
agtgtcctgccggagcacgtcgcggtaaagatgcggcaggacctcggcgcctccctcgac
acgcagttcaagaagatctacatgtccaggcacgagaacgtgtcgatactttacgccgac
atagtcggcttcaccgcgatctcgtcgacctacagcgccagcgaactggtcaagatactc
aacgagctttttgcgcgattcgatcagctcagcgaaagatacgagcaattgcgcatcaag
atcctgggggactgttactactgtataagtggtgcacccgtcgaaaggccagaccacgcg
gtcctctgcgtatatatggggctgtccatggtggaggcgatcaagtacgttcaacagacg
acaaacagtccggttgacatgagggtgggcattcacacgggtgcggtgctcgccggggtg
ctcggacagagacagtggcaattcgacgtctacagcaaggacgtcgagctggcgaataag
atggagagcagcgggatggccgggagggtacacatctcgaacgcgacgctgagcttccta
aacggagaattcgaggtcgagccggcgcatggcgagcatcgggaagaggcactccaaaaa
gctggccttgtcacttactttatagtgagagccttgaagccatttaagccggcggtaacg
aagagcctggcgtcactggtggacgcggaaaattcgcgaaagacaatggaaaatgcgccg
gatagcgggaacaacaaagaggactcggaggagtttcgacaacagctgagaaagaaactc
gacagaggtggtggcaccgacctgaaatgtcactcctcctggttgaccctgcggttcaag
gatccgaaagtggagacggcctttcacagcgccgaggaggccttctcacctctctcgctg
ttcggcggacctctgataaccctgtgcgcggctccggtctggaggtttcaaccctgggga
ccgttcacgtggggtggcgccggggtggtcgccctgttcggtctcgtgttggctggagcg
acctgcctgggcagcgccgtcagggcgacctggctgaggaaaaccctcgcgatcctgatg
gcattctccctcatagaattcctgctgttggacatgagtaactgtgcgatcatcaccgac
gtcgagccaccgagcaactcctcggtaaactggccaactctacgttgcccgtatccctct
tactactcgtacatcggcgtcctcgcgctggtcgcggtctcgatgccgacgtatctctgt
tacttgtacaaggcgttcctcatgtatattctcgccggtgggcaatgttgctacaacatc
ctgttcctcgcaccgaccatcgacagggaggacgtgatgtcgagcccacatggaaaggaa
cctcgtttcccgctgaaatactcgctgtcagccgttctgctcatcatcgcgaccgcgttg
gtcatcgtggcgagatacgctgagaaggcgcgaaggatgctgtacctgagaggacgcgag
gtgatcgcgcagaaggagcgagcggcggacatgaagcggaggaacggcgtgctgatatac
aacatcctgccgccgcacgtggccgtgcattttctgtcgagtgcgaggcatcacgatgat
ctctacagtcagagctacgctgaagtcggtgtgctgttcgccagtataccgaatttcgcg
gacttctacacggaggagaccatcaacaatcaaggtctcgagtgcctgaggtttctgaac
gaggtcatctcggactttgacgccattcttgatcagaataaattcaaggataccatcatc
aaaatcaagacgataggatcgacctacatggccgcctcaggcatcaccgagtcggtggag
acggaagacggtccccgatggggtcatctgtccactctcgtggagttcgccctggagctt
aagaaagccctgtcgggcatcaacgagcaaagcttcaatcacttcgtcctgaaaatgggc
atcaatcacgggccggtgaccgccggggtcatcggggcgagaaagcctcactacgatatc
tggggcaacaccgtgaacgtagcttcgaggatggagagcacgggaaaagtcggctgcata
caggtgaccgacgaaacgcgacggatcctggagccgttcggcttcggcttcgagcaacga
ggtctcgtcgacgtgaagggcaagggacagctgttgacgcactaccttatatccaaagac
ggtgtgtctctggacctcgatagcgatcttcccgtcgagcctactcatcctataatctat
cagtaa

DBGET integrated database retrieval system