KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105190387Help
Entry
105190387         CDS       T03918                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:hst00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105190387
Enzymes [BR:hst01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105190387
Chromosome and associated proteins [BR:hst03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105190387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW Med26
Motif
Other DBs
NCBI-GeneID: 105190387
NCBI-ProteinID: XP_011151428
LinkDB All DBs
Position
Un
AA seq 1831 aa AA seqDB search
MARKRKTEVKASVKSSHRYVPVRKSSRQIAKKQMEEKKNGEISQTSYLNNFDDSKSTNED
QVDSKSTSGSQVSSRKNQNLQKKHNKHKDTSNNSVTINDENTIYDASQCKRDAGDSDSQD
DTDNIIAKSEKLSPEDVRQVVVGNTNPSNESLSAPISTEMEVWSEDVIEETIICEEMDVE
EDGANLPQDNVMVEQVLLVNEPNLEDKDFVEFTVIQNEDGTKSMVMASKSENVSNDEYCA
IQRSVNSMCTSAPENSISMMQTNESVISSSENCNITDPSVNKPYVNKKKTVLEDKFNRKQ
KSGKTIYDKIRKEISESISDKVQICSVNDYSGSSNELLEDNCKWESKDLQTKNVYKDLSK
EDTVSKLDNKLADMQISECSKEIQKLVNDLSSVENIDSPVQTPLTIEKLSPVNIDEESSS
SILDKMEQLHHPNNSVSSHITDIFSNAMEPNNIMKNEEQDILKSDSYNDKIQCTDQISLK
SRIIQDKKNTHQQKNMEHLEIIDEFQDSEGDNKVDNEDMKLCSSSENSNDTLLSLTNCKT
RELDVKNITNNANDIDKRVEFRSRSGSTDTTGSESGSNSSGVRRSSRIRSIGLMKQRSRG
RGLVTKPNIDTSKVTLQQEKEKVVNNINPAITQEIKVDNSEAQCDKENSSNKISTSLDTL
APLSTSYNTTGYDSDSSKPVKVKSRWRRSSELEMGSSSASFGYLTSSVSMLGSSVAPLSE
LGRSTSVNTGESTSSESKHNIISTNIKTSVETEQVKDTLLTSNNVSIASTIAQNLKAIGA
KIPLPMVLGTEDREMEERLSQFEHLRENLYLTERYTNKETKRMVCDCFLTEEEIERGELG
CGEDCLNRLLMIECGPRCVVGDRCTNKRFQNCEYAKCEVFRTEKKGFGLRAIVDIMAGEF
IMEYVGEVVDPKDFRRRAKEYSKDKNRHYYFMALKSDQIIDATMKGNVSRFINHSCDPNA
ETQKWTVNGELRIGFFNKKFIAAGEEITFDYHFQRYGKEAQKCYCEAPNCRGWIGETPEE
EKEKIEKKEKREKDTKKKKEEKKPADYMEDEDLEEEIDKLCSGGLKNRAHTLTLSRLMVR
SRELEHRTRLLRLIQSGVQPCRRLFLDYHGLRLIWSYVMDIATNDTEEAQQFRLEVLKTL
NTLPIPNKTMLMDSKIYGVVEKWAKGLYLSPNADSPEDDQVKSKTICEDLSSNSDSNEKK
SPEHLHDIPDKRNNNIENCLAVNEIKLETPEQALIPDLASSLLAEWSNLKEVFRIPKKER
IEQMKEHEREADRGYREELEKEDKRGTSYDRHRSDRYTRSEMEKRGDRRRGRESPETEHN
RVKEKRVEERSSLVPIPRMTKYERRQLFALQVAKEEEERQRRQQQESWQEHENRCLALGI
DPHTTAMVDPQTGYPVFYNPSLGQWQHYSTQEGGEVTQQCTPIYVGPQSTNIIGQTSHVL
PSSMTTDISSGITSGISPGVPSVAYSLSQTTVFSQTSSSYSLISHPQPYSEGQLPVPNSL
VSVHGGTPPISIQTPLYNHLEKPADQFTSAENRPSQPEVPPIDLPPKWKSATDSRGRTYY
YHVKERISQWLPPPPDHIGVQPDSSSTSESSEESSSSNEDDEDLDDDHTEDQRNDDMETS
NVSTESPSSTSRPNMSKKLSGHNLTGSSLPFTEPKKRREGLVQERIISPRREEDRIDHKV
YKEIKEKLRRQKERAKLKDHVEKLRKHRRSNKSKSHSRHGLSKLQSTSAEMSPMSERKIK
DTFRINMANVMVHFLNPYRKNDCKQGRITNTEDFKHLARKLTHFVLAKELKHCKSVDELQ
CNENVKHKAKDFVRKYMSKFGAVYQKGTDED
NT seq 5496 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaaacgtaaaactgaagttaaagcatctgtaaaatcatctcatagatatgta
cctgtacgtaaatctagtagacaaatagccaagaagcagatggaagaaaagaaaaatgga
gagatttcacagacatcttacttaaataatttcgacgattctaaatctactaatgaagat
caagtagattccaaatctactagtggaagtcaagtttcatcaaggaagaatcaaaatttg
cagaagaagcataataaacataaagacacttctaataacagtgtaactataaatgatgag
aatactatatatgatgcttctcaatgcaaacgagatgcaggagacagcgatagccaagat
gacacagataacataattgctaaatctgagaaacttagcccagaggatgtacgacaagtt
gtagttggtaacacaaatccaagtaatgaatccttatctgcaccaatatcaacagagatg
gaagtgtggtcagaagatgtcatagaggaaacaataatttgtgaagaaatggatgtggaa
gaagatggtgctaatttgccgcaagataatgttatggttgaacaagtactgcttgtgaat
gaacctaatctggaagacaaggattttgtggaatttactgtgatacaaaatgaggatggt
actaagtctatggtaatggcatctaaatctgagaatgtttcaaatgatgagtattgtgct
attcaaagaagtgttaatagtatgtgtaccagtgcaccagaaaattccatatcaatgatg
caaacaaacgaatcagtgatttcaagcagtgaaaattgtaacattacagatcccagtgta
aacaaaccatatgttaataaaaagaaaacagtattagaagataagtttaatagaaaacaa
aagagtggtaaaacaatttacgacaaaataagaaaggaaatttcagaatcaatatctgat
aaagttcaaatatgttctgttaatgattattctggctccagtaatgagttattagaagat
aactgcaagtgggaaagcaaagacttacaaacaaaaaatgtgtataaagatttgtcaaag
gaagacacagtttccaaattggataacaaattggcagatatgcagataagtgaatgttca
aaggaaatacaaaaattggtgaatgatctttctagtgtggaaaatattgactctccagta
caaactcctttaactatagaaaaattgtcaccagtaaatattgatgaagaaagcagttcg
tcgatattagataaaatggaacaattacatcatccaaataattctgttagctctcacatt
acagacatattttcaaatgctatggagcccaataatataatgaaaaatgaagaacaagat
attttaaaatctgattcttacaatgataaaatacaatgtacagatcaaatttcattgaaa
tcgagaatcatacaggataagaaaaatacacatcagcagaagaacatggaacatttagaa
attattgatgaatttcaagacagtgaaggggataacaaagttgataatgaagatatgaag
ctatgcagcagcagtgaaaatagtaacgacacacttttgtcactaactaattgtaaaact
cgggaacttgatgtaaaaaatataacaaacaatgcaaatgatattgacaaaagagttgaa
ttcagaagtcgtagtggaagcactgatacaacaggttctgaaagtggctcaaatagttcg
ggtgtaagacgaagtagtagaattcggtctattggattaatgaaacaaagatcacgtgga
cgtggcttggttacaaagcctaacatagacacttcaaaagtaactcttcagcaagaaaaa
gaaaaagtagttaacaatataaatcctgcaattactcaggaaataaaagtagataactcc
gaagcgcaatgtgataaggaaaatagttctaacaagatatcgacgtcgcttgatacttta
gctccattaagtactagttataataccacaggatatgattctgattcttcaaagccagtt
aaagtaaaatctcgctggcgaagatcgagtgagctggaaatgggaagttctagtgcaagc
tttggatatcttactagttctgtatcaatgcttggatcatctgttgcacctttatctgaa
ttaggacgttctacatctgttaatacaggagaatctacatcttcagaatcaaagcataac
attatcagcacaaatataaaaactagtgtagaaacagaacaagtcaaagatacgttatta
acatctaataatgtttctattgcttcaacaattgcacaaaatctaaaagctattggagca
aagattccattgccaatggttcttggaacagaggatagagaaatggaagaaagactgagt
cagtttgagcatttacgtgaaaatttgtatcttactgaaagatatacaaataaggaaact
aagagaatggtgtgtgactgtttcttaactgaagaagaaattgagagaggagaacttggt
tgtggagaagattgccttaatagactcctcatgatagaatgtggacctagatgtgtagta
ggggacagatgtacaaataaaagatttcaaaattgtgaatacgctaagtgtgaagtgttc
cgcacagagaaaaagggttttggattacgtgctatcgttgatataatggcaggcgaattt
ataatggaatatgtgggtgaggttgtagatccgaaagattttagacgtagggcaaaagaa
tattctaaagataaaaacagacattactatttcatggcactaaaatctgaccagattata
gatgctactatgaaaggtaatgtgtccagattcatcaatcatagttgtgatccaaatgcc
gaaacacaaaagtggacagtaaatggggaattacgaataggattttttaataaaaaattc
atagctgctggtgaagaaataacatttgattaccatttccaacgttatgggaaagaagct
caaaaatgttattgtgaagcaccgaattgtcgaggttggataggtgaaacacctgaagag
gagaaggagaagattgaaaagaaggagaaacgcgaaaaggatacaaagaagaagaaagaa
gagaagaaacctgctgattatatggaggatgaagatttggaagaagaaatagataaactg
tgctcaggtggtttgaagaaccgtgcgcacacattaacattaagcagattaatggttcgt
agcagagaattagaacacagaacgcgtttgctacgtcttatacaaagtggcgtacaaccg
tgtcgaagattatttctggattatcacggtttacgtttaatatggagttatgttatggat
atcgcaacgaatgacacagaagaagctcaacagtttcgcttagaagtgttgaaaactcta
aatacactgccaatacccaacaagacgatgttaatggatagtaagatatatggtgtagtt
gagaaatgggcgaaagggttatatctttctccaaatgccgattctccagaagatgatcag
gttaaatcaaagacaatttgcgaagacttgagcagcaattctgacagcaacgaaaagaaa
agccctgagcacttgcacgacattccagataaacgcaataacaacattgaaaattgtttg
gcagttaacgaaattaaattagaaactcctgaacaagctcttattcccgatttagcttct
agtcttcttgccgagtggtccaatcttaaagaagttttcagaataccaaaaaaagaaagg
attgagcaaatgaaagaacatgaaagagaagcagatcgcgggtatagagaagaactggag
aaagaagataagagaggaacatcttatgataggcatagatctgatagatatactcgaagc
gaaatggagaaacgcggtgacagaagacgaggacgagaatctccagaaactgaacacaat
agagtaaaagaaaaaagagtagaagaacgaagtagcttagttcctataccacgcatgaca
aaatatgagcgtaggcaattatttgcactacaagtcgcaaaagaagaagaggaaaggcaa
cgtcgtcaacaacaagaatcgtggcaagaacacgaaaacagatgtttggcattgggtata
gacccccataccactgccatggttgatcctcaaactggttatcctgttttttataatccg
tcattaggacaatggcagcattattccactcaagaaggaggagaagtaacgcaacagtgt
actcctatatatgtaggccctcaatctactaatataatagggcagacttctcatgtacta
ccatcatcaatgacaactgatatatcgtccggcattacaagtggcatttcgcctggtgtg
ccatcagtagcttattcattaagtcagacaactgtgttcagtcaaacatcatcctcctat
tctttgatatcacacccacaaccatattccgaaggacaactacctgttccgaatagttta
gtgtctgttcacggtgggacacctcctatatcaattcaaacacctctttataatcacctc
gagaagcctgctgatcaatttacatctgcggaaaatcgaccgtcgcaacctgaggttccc
ccaatagatttaccaccgaaatggaagagtgcaacagacagcagaggtagaacatattat
taccatgtgaaggaaagaatatcgcaatggctacctccaccacctgatcatattggggta
caaccagactcctcgtctacttcggaatctagtgaagaatctagctcgtcgaatgaagat
gatgaagatctcgatgatgaccataccgaggatcaaaggaatgacgatatggagacaagc
aatgtttcaacagaaagcccttcgagcacatctaggccaaatatgtctaaaaagttaagt
ggtcacaatctgactggaagttcactgccgtttaccgagcctaagaaaagaagagagggg
ctggtacaagaaagaattattagtccacgtagggaagaagatcgtatcgaccacaaagtt
tataaagaaataaaagaaaaattacggcggcagaaagagagagcaaaactgaaagatcat
gttgagaagttaaggaaacatcgacgaagtaataaatcgaaatcacattcgcgacatgga
ttgagcaagttgcagtcaacatcagccgaaatgtctcctatgtctgaaaggaaaatcaag
gatacatttagaataaatatggctaatgtaatggtgcactttttaaatccatatagaaag
aatgattgcaaacaaggtagaataactaatactgaagattttaagcatctagctagaaag
ctaacacattttgtacttgcaaaggaattaaaacattgtaaaagtgtcgatgaattacaa
tgtaatgaaaacgttaagcacaaagcaaaagactttgtacgtaagtacatgagtaaattc
ggcgcagtgtatcagaaaggtacagatgaagattag

DBGET integrated database retrieval system