KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105190983
Entry
105190983         CDS       T03918                                 

Definition
(RefSeq) protein salvador homolog 1 isoform X1
  KO
K16686  scaffold protein salvador
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst04214  Apoptosis - fly
hst04391  Hippo signaling pathway - fly
hst04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hst00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04391 Hippo signaling pathway - fly
    105190983
   04392 Hippo signaling pathway - multiple species
    105190983
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    105190983
SSDB
Motif
Pfam: WW
Other DBs
NCBI-GeneID: 105190983
NCBI-ProteinID: XP_011152350
LinkDB
Position
Unknown
AA seq 397 aa
MLSRKNKDLRTIKEGVEGKYVKKETPPEMPNCIITIFHLHLVINVWTTEPNKRTRRRNNH
PAMPSSMSVPQQPSMVQKFGNTKTTPSAVGLGSHEGKYTPNSSVPDLAQRFASLSVNTGT
NDGMPSRTATPMYHAELSPAMSHTYINQYAGSEYHLDRVQTPQMPYMPFDVDTGYEDYNR
SAYRQNAGYSRCHSERSSSRSEQQEELPLPPGWSVDFTLRGRKYYIDHNTKTTHWSHPLE
KEGLPTGWERIESPEYGVYYVNHITRQAQYEHPCYPHEMQAVRVVSPPRHTHFHSHSVLV
PANPYLNEEIPHWLYVYSRASIALDRKLRWELFRLPELDCFNAMLTRLYKQELEEVVMRY
EEYRSSLLCEMDQRLKELRPESSGSNAGAVALRRSLP
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgctgtcgcgtaaaaacaaggatctgaggacgatcaaggagggcgtcgaagggaaatac
gtgaagaaagaaacgccgcctgaaatgccaaattgcattataacaatttttcatttacac
ttagttatcaatgtatggacaacagagccgaacaaaagaacaagaagacgtaacaatcat
ccagcaatgccaagttctatgtccgtccctcaacagcccagtatggtacagaaattcgga
aatacgaaaactactcccagtgctgttggtctcggtagccatgaaggcaaatatacaccg
aacagttccgtcccggacttagctcaaaggttcgctagtctttccgttaacacagggacg
aacgacggcatgccctcgaggactgcgacacctatgtatcatgccgaattgtcgcccgca
atgtctcatacttatattaatcaatatgctggatctgaatatcatctagacagggttcag
acaccgcaaatgccttacatgcccttcgacgtcgacaccggttacgaagactataatcgc
tccgcgtaccgtcaaaatgctggctacagtagatgccactcggagagatcgagttctcgg
agtgagcaacaagaggaattgcccttgcctcctggatggtcagttgatttcacgcttcgt
ggtcggaagtattatattgatcacaatacgaagaccacgcattggtcacatccgctcgag
aaggagggtctacccactggttgggagagaatcgaatcacccgagtacggcgtttactat
gtcaatcacatcacgcgtcaagcgcagtacgagcatccttgttacccgcacgagatgcaa
gcggtgcgtgtggtttcaccaccgcggcacactcatttccactctcacagtgtcctggtc
ccggccaacccttatctcaacgaggaaataccgcattggttgtacgtgtacagcagagcc
tcgatcgctctagatcgtaaactacgctgggagctctttcgactgcctgaattggactgt
ttcaacgccatgctcaccaggctgtataagcaggaactggaagaggtcgtgatgcgctac
gaagagtatagatcttccttattgtgtgagatggatcagagactgaaggaattgagacca
gaatcaagtggctctaatgctggtgctgttgcattacgaagatctcttccttga

DBGET integrated database retrieval system