KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105191541Help
Entry
105191541         CDS       T03918                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial isoform X1
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00250  Alanine, aspartate and glutamate metabolism
hst00280  Valine, leucine and isoleucine degradation
hst00410  beta-Alanine metabolism
hst00640  Propanoate metabolism
hst00650  Butanoate metabolism
hst01100  Metabolic pathways
Module
hst_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:hst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    105191541
   00650 Butanoate metabolism
    105191541
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105191541
   00280 Valine, leucine and isoleucine degradation
    105191541
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105191541
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hst01007]
    105191541
Enzymes [BR:hst01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     105191541
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     105191541
Amino acid related enzymes [BR:hst01007]
 Aminotransferase (transaminase)
  Class III
   105191541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 105191541
NCBI-ProteinID: XP_025161501
LinkDB All DBs
Position
Unknown
AA seq 532 aa AA seqDB search
MLVNKCTLAARASPRQLLNEVLPLADRLESEKCSNLIRRRKTRTCERSSVYNIAGVATWR
RCLTGSTSSREPARPVVATEIPGPQSRNMLQELNAIQQASSVQFFVDYEKSVGNYIVDVD
GNALLDVYMQISSMPLGYNHPAMLEALADPVNQKIMANRPALGVFPGSQWAERLNRVLLK
SGVAPPGLSHLTTMMCGSCSNENAFKNIFIWYAEKRRQGAPFTEQEMESCMMNQIPGSPR
FCIMSFKGAFHGRTLATLSTTHSKYIHKMDIPAFDWPIASFPEYKYPLEENMRHNQQEDK
RCLAEVEGLFEKFEKEKKTPVAGVIIEPIQSEGGDNHASPEFFQELQRITKKNGAALLID
EVQTGGGPTGKMWCHEHFCLDAPPDLVTFSKKMQLGGYYHMKAFKPKQPYRVFNTWMGDP
SKVILLEAILDVIKKENLLDRVTHVGDYVMKHLMDMQKGHSGKISAVRGRGTFIAFNCAS
PEIRDALIKKLQTKGIQTGGCGQQAVRLRPALTFTKHHADIFLDALRSSLKE
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgttaacaagtgcacgctggccgcgcgtgcctcgccccgacagctactcaatgaa
gtgcttcccttggccgaccgtctcgagtcggagaagtgctccaatctaatacggagacga
aagacgcgaacatgcgagcgttcatcggtctataatattgcaggcgttgcaacctggagg
agatgcttaaccggttccacgtcgtcgagagaaccagcaaggccggtagtcgcgacggag
ataccgggtcctcagtcgcgcaatatgctgcaggaattgaacgcgatacaacaagcctct
tccgtacaattcttcgtagactacgagaaatccgtcggcaattacatcgtggacgtcgac
gggaacgcgctgctggacgtttacatgcaaatctcatcgatgcccttagggtacaatcat
ccggctatgttggaggctctcgccgatcccgttaatcagaaaatcatggcgaaccgaccg
gccttaggcgtctttccgggcagtcagtgggctgaaagattgaacagggttctgctgaag
agcggggtcgctccgcccggattgtcgcatctcacgacgatgatgtgcggctcctgctcc
aatgaaaacgccttcaagaacatattcatctggtacgccgagaaacgaagacaaggcgcg
ccgttcaccgagcaggagatggaatcctgcatgatgaatcagattcctggctcaccgcgg
ttctgcatcatgtctttcaaaggagcattccacggtagaactctggccactttgtcgacc
acccacagcaagtacattcacaagatggatataccagccttcgattggcctatcgcttcc
ttccccgaatacaaatatcccttggaggagaatatgcggcataatcaacaggaggataaa
cgttgtctcgcagaggtcgagggactgtttgagaaatttgagaaggagaagaaaacaccg
gtggccggtgtgataattgagcctattcaatcagaaggcggtgacaatcacgcgtcgccc
gagttctttcaggaactgcaacgcataaccaagaagaatggggcggcgcttcttatcgat
gaagtgcaaaccggtggtgggccaacagggaagatgtggtgccacgagcacttctgccta
gacgccccacccgacttggtgaccttcagcaagaagatgcaattgggcggttattatcac
atgaaagctttcaagccgaaacaaccgtatcgcgtgttcaacacttggatgggcgatccc
agtaaggtgatcttgctagaagcgatcctcgatgtgataaagaaggagaatcttttggac
agggtgacgcacgtcggtgattatgtgatgaaacatctaatggatatgcaaaaggggcat
tccggtaagataagcgcggtgcgcggacgcggtacgtttatagcgtttaattgcgcctca
cctgagattcgagacgctcttatcaagaagcttcaaaccaaaggtatccaaacgggcggc
tgcggccaacaagctgtgcgactcaggcccgcgttgactttcacgaagcatcacgccgac
atatttttggacgcgctccgctctagcctaaaggaataa

DBGET integrated database retrieval system