KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105191959
Entry
105191959         CDS       T03918                                 

Definition
(RefSeq) stress-activated protein kinase JNK isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst04013  MAPK signaling pathway - fly
hst04068  FoxO signaling pathway
hst04137  Mitophagy - animal
hst04140  Autophagy - animal
hst04141  Protein processing in endoplasmic reticulum
hst04214  Apoptosis - fly
hst04215  Apoptosis - multiple species
hst04310  Wnt signaling pathway
hst04391  Hippo signaling pathway - fly
hst04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:hst00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105191959
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    105191959
   04310 Wnt signaling pathway
    105191959
   04391 Hippo signaling pathway - fly
    105191959
   04068 FoxO signaling pathway
    105191959
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105191959
   04137 Mitophagy - animal
    105191959
  09143 Cell growth and death
   04214 Apoptosis - fly
    105191959
   04215 Apoptosis - multiple species
    105191959
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    105191959
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hst01001]
    105191959
Enzymes [BR:hst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     105191959
Protein kinases [BR:hst01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   105191959
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 Kinase-like RIO1 APH FTA2 TCAD9
Other DBs
NCBI-GeneID: 105191959
NCBI-ProteinID: XP_011154113
LinkDB
Position
Unknown
AA seq 389 aa
MPYLGPDMTTRLSAMFYTVEVGDTKFTILKRYQNLKPIGSGAQGIVCAAYDTVTAQNVAI
KKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRSLDEFQDVYLVMELMDAN
LCQVIQMDLDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLAR
TAGTTFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIRGGVLFPGTDHIDQW
NKIIEQLGTPAQEFMQRLQPTVRNYVENRPRYPGYPFERLFPDVLFPSDSSEHNRLKASQ
ARDLLSRMLVIDPERRISVDEALLHNYINVWYDEGEVNAPAPGPYDHSVDEREHTVDQWK
ELIYQEVMEYETSHNPAAVAASSESSGSR
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgccttacctggggcctgacatgacaacccggctgtccgccatgttctacacggtcgag
gtcggggacaccaagttcaccatcctgaaacggtaccaaaatctcaagcccatcggctcg
ggcgcgcagggaatagtctgcgcggcgtacgacactgtcactgcgcagaatgtggcgatc
aagaagttgtccagaccctttcaaaacgtgacacacgcgaagagggcctaccgagagttc
aagctgatgaagctggtcaaccacaaaaacattatcggtctcctgaatgcgttcacgccg
cagcggtctctggacgagtttcaagacgtgtacctggtgatggagctcatggacgcgaat
ctgtgccaggtaatccaaatggatctggatcacgaacggatgtcctacctcctctatcag
atgctgtgcggcatcaagcacttgcactccgccggcattattcatagggatttaaagccg
agtaacattgtcgtaaagtcggactgcacgctgaagatcctcgacttcggcttggcgagg
accgccggcaccacattcatgatgacaccttacgtcgtcacccgatattatcgggcacca
gaggtgatcctcggcatgggatacaaggagaacgtggatatctggtcggtgggctgtatc
atgggcgagatgatacggggcggagtgctcttcccgggcacggatcatatcgatcaatgg
aacaaaataatcgagcaactgggtactccggcgcaggaattcatgcaacggctgcagcct
actgtcagaaattacgtggagaacaggccgcgatatccgggctaccccttcgaaaggcta
tttccggacgtgctgttcccctcggattcgtcggagcacaatagattaaaagcgagtcaa
gccagggatctattgtcgcgcatgctcgtgatcgacccggagcgacgcatttctgtcgac
gaggcgttgctgcacaattacataaatgtctggtacgacgagggagaagttaatgctccc
gcaccgggaccgtatgatcacagcgtggacgagagagagcacacggtggatcagtggaag
gaactgatctaccaagaggtcatggaatacgagacaagccacaatcctgcggcggtagct
gcgtcgtcagagagttctggaagccggtag

DBGET integrated database retrieval system