KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105192036Help
Entry
105192036         CDS       T03918                                 

Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Brite
KEGG Orthology (KO) [BR:hst00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hst01009]
    105192036
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hst03019]
    105192036
   04131 Membrane trafficking [BR:hst04131]
    105192036
   03036 Chromosome and associated proteins [BR:hst03036]
    105192036
Enzymes [BR:hst01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     105192036
Protein phosphatases and associated proteins [BR:hst01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105192036
Messenger RNA biogenesis [BR:hst03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     105192036
Membrane trafficking [BR:hst04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    105192036
Chromosome and associated proteins [BR:hst03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     105192036
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP zf-UBP_var
Motif
Other DBs
NCBI-GeneID: 105192036
NCBI-ProteinID: XP_011154195
LinkDB All DBs
Position
Unknown
AA seq 1184 aa AA seqDB search
MAEHVKKTDLFTAAKHLAESEVELIKVIENSSKCQKTAENMPANIKKMKKPGKSGNIRPS
AALLAAKREAAQRQLLVGKKSNNNFVQDIYQKAIDSYEIIHKDTGLVFDRSMAEHECLWD
LDYAECPARFTQVLQRCEELGLVQRCKLIKARLATENEILMKHSQKHIDILKATDGCMDS
ENLELLSSKYDSIYVHPSTYRLSLLATGSTINLIESICKGKVQNGMAIVRPPGHHAMKSE
YCGYCFFNNVALAAEKALTSNWASKILIVDWDVHHGQATQQMFYNDPRVVYFSIHRYEYG
EFWPNLRESDFHNVGEDLGEGFNFNIPLNKTGMTNADYIAVFQQILLPMAYEFQPDLVIV
SAGYDAALGCPEGEMLVTPACYSHLLSSLLSLAAGKVAVVLEGGYCLKSLAEGAALTLRT
LLGDPCPILQTLDLSSLSIRDTILNVIYAHRPYWKCYQYQDTHSINIVNYNKEEIANQHV
VTVIYNRSNQIKPEKYETRNCYPKQNKEDVEVIDKKLDELMHFTNLYKAPHKVCIVYDER
MLKHCNISDNSHPEKPTRISSIYRNHEEYNLLERCYLLHGRCATIEELSLVHSKDYIDSI
KSIMTLKLKELDKEAAGYNSVYFHNETWSSACISVGSLLQIVDAVLNGESQSGVAIVRPP
GHHAEEDAACGFCIFNNVAVAAKYAIQFHHVKKVLIVDWDVHHGNGTQAIFEEDPKVLYT
SVHRYDNGSFFPSSKDANYTSVGLNAGEGFNVNVPWNKKGMGDVEYIAAFQQVIMPIAYQ
FNPELVLISAGFDACVGDPLGGCHTNPELYGHLTHWLSSLANGRVILSLEGGYNINSISH
AMTMCTKALLGDPLPMLGPGQVPCTSAINSINNVLKTHKKFWPNLQYGMSLPKEKLLPKL
KMISKRESSKRDKKLEECGRDLEKPKQTESKIALEGIQSEKLELSLCIDKNCLNFVTDEE
ILKLKNEVENIKIKNSEMDIVKNDADEARRNVGSKKNKAKTLDVSQIIQKCVKDTNQSRD
NQQGSSGTCDDNDDEGAGALQREIQTTNLLDYLSDHLQALTAGEMFAVVPLRDCPHLFMV
NEVPPSGIDMTLPCTECASTAENWICLQCYTVHCARNVNQHAIQHAEEYLHPIALSFSDI
SVWCYGCEAYIDNSQLYAARNAAHQSKFNEVLPWTYSESSTHTS
NT seq 3555 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacatgtaaagaaaactgatttatttactgcagccaaacatttagcggaaagc
gaagttgagttgataaaagtgattgaaaactctagcaagtgtcaaaaaactgctgagaat
atgcctgcaaatataaagaaaatgaaaaagcctggaaagtcaggaaatatccgtccatca
gctgcactattggctgctaaacgagaagcagcacagcgacaacttctagtaggaaaaaag
tcaaataacaattttgtacaagatatataccagaaggctattgattcatatgagataata
cataaggacactggtctcgtatttgatcgaagtatggcagaacatgaatgcctttgggat
ctagattatgctgagtgtccagcaagattcacacaagtactacagagatgtgaagagtta
ggtttagtgcaacgatgtaaacttatcaaagcaagattagcaacagagaatgaaattttg
atgaaacatagtcagaaacatattgatattctgaaagctactgatggctgtatggactct
gagaatttagaactgttgtcgtccaagtacgactctatttatgttcatccatccacatat
agattatctttattggctacgggttcaacaattaatttgatagaaagtatttgcaagggt
aaggtacaaaatggcatggctattgttagaccaccaggccatcatgcaatgaaatcagag
tactgtggttactgcttcttcaacaatgtagcacttgcagcagagaaagctctaacttcc
aattgggcgagtaaaattttaatcgtcgattgggatgttcatcacggacaagcaacacaa
caaatgttttacaatgatccgcgtgtagtctatttttcgatacatcgctacgaatatggt
gaattctggcctaacttaagggaatctgacttccataatgttggagaggaccttggagag
ggtttcaacttcaatatacctctgaataaaactggcatgactaacgctgattatattgcg
gtttttcagcaaattttattgccaatggcttatgagtttcaaccggatctggtaatagtg
tcagctggttacgacgctgctctcggttgtccagagggagagatgttagtgactcctgca
tgttattcacacttactttcatcattattaagcctggcggctggaaaagttgccgtcgtt
ctagagggcggctattgcttgaaatctttagctgaaggcgcagcactgactttaaggact
ttattaggtgatccatgtcctattttacaaacacttgatctatcttcattgagtatacgt
gacactattttaaatgtaatctacgcacatcgcccatattggaaatgttatcagtaccag
gacacacatagtattaatattgtaaattacaataaagaggagatagctaatcaacatgta
gttacagttatatataataggagcaatcaaattaaaccagaaaaatatgagactcgaaat
tgctatcctaaacaaaacaaagaagatgttgaagttatagataagaaactggacgaatta
atgcattttacaaatttatataaagcaccgcacaaagtatgtattgtctacgatgagaga
atgttaaaacattgtaatatttccgacaattctcatccagagaagccaactcgtatctct
agcatctatagaaatcacgaagagtataatttactagaacgctgctatttattacatgga
aggtgtgcaacaatagaagaactatctttggttcactcaaaagattacatcgacagtatc
aagagcataatgacattaaaacttaaagaattagacaaggaagctgctggttacaattct
gtttattttcacaatgaaacatggtcaagtgcctgcatatctgttggatccctactgcaa
atagtggatgcggttttaaacggagaaagtcaatccggagtagctattgtaagaccacca
ggacaccatgctgaggaagatgctgcatgtggtttttgcatctttaataacgtggcagta
gctgcaaaatatgccatacaatttcatcacgttaaaaaggtactgatagtcgattgggat
gttcatcacggaaacggaacacaagctattttcgaagaagatccgaaagttttatataca
tctgtccatcgttatgataacggaagcttcttcccaagttctaaagatgctaattatacg
agtgttggtttaaatgcaggcgaagggtttaacgtaaatgtaccgtggaacaagaaagga
atgggagatgtagagtacatagcagcattccagcaagttataatgcctattgcttatcaa
tttaatccagagctagttttaatctctgctggatttgatgcttgtgtaggtgatccactg
ggaggttgccacacaaatccagaactctatggtcatttgacacattggctttcatccttg
gccaacggtcgcgtaatcctcagccttgaaggaggttacaacatcaattctatttctcat
gcgatgactatgtgtactaaagcccttctaggcgatcctttgccaatgttgggacctggt
caggtaccctgtaccagcgcgatcaattccatcaacaacgttttgaaaactcataaaaaa
ttttggcccaatttacaatacggaatgtctttaccaaaggaaaagttacttcctaaactc
aagatgatttctaagagagaatcctctaagagagataaaaagctcgaagagtgcggaaga
gacttggaaaaaccaaaacaaacggaatcgaaaattgccttagagggaattcaaagcgag
aaattggaattaagtttgtgtatcgataagaattgcttaaattttgtaacggatgaagag
attctgaagctgaaaaacgaagtagagaatattaaaattaaaaattctgaaatggatata
gtgaaaaatgacgctgacgaggcgaggagaaacgttggatcaaagaagaacaaagcgaaa
actttggatgtttcacagattatacaaaaatgtgtaaaggacacaaatcaatcgagagat
aaccagcaaggaagttctggcacatgtgatgacaatgatgacgaaggagctggagcacta
caacgtgaaatacaaactacaaatcttctggactatctttctgatcatcttcaggctctg
acagcgggagaaatgtttgcggtggtgcctctgcgagactgtccacatctattcatggtt
aacgaagttcctccaagtggaatcgatatgactttaccttgcacggaatgtgctagtact
gcggaaaattggatctgcctgcaatgttacaccgtgcactgtgctcgcaatgtcaatcag
cacgcgatacagcatgcggaagaatacctgcatcctatcgcactcagtttcagcgatatt
tccgtctggtgctatggttgcgaagcatatatcgataattctcaattatatgcagcaagg
aatgcagctcatcaaagcaaatttaatgaagtgcttccctggacttatagtgaaagtagt
acacatacatcttaa

DBGET integrated database retrieval system