KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105192139
Entry
105192139         CDS       T03918                                 

Definition
(RefSeq) serine/threonine-protein kinase Warts
  KO
K08791  serine/threonine-protein kinase LATS1/2 [EC:2.7.11.1]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst04214  Apoptosis - fly
hst04391  Hippo signaling pathway - fly
hst04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hst00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04391 Hippo signaling pathway - fly
    105192139
   04392 Hippo signaling pathway - multiple species
    105192139
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    105192139
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hst01001]
    105192139
Enzymes [BR:hst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105192139
Protein kinases [BR:hst01001]
 Serine/threonine kinases: AGC group
  NDR family
   105192139
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr UBA ABC1 Haspin_kinase APH Kinase-like Seadorna_VP7 TMEM252
Other DBs
NCBI-GeneID: 105192139
NCBI-ProteinID: XP_025161210
LinkDB
Position
Unknown
AA seq 1102 aa
MNPPAVSKLSTRGSGYHQKALAEIRNSLLPFANIGGAGEVGSSAASTISTLSTTSGISSA
SGLSGLSGASGSTVDKPDQRQALGQLLAMGYSEEIGVRALKLCGWRLDAAIEFLKQAQGG
ESLNGLGKLNTKLIRKPSLERELSLQRGSPALDSGAGSSRSDSPRLTELSPHPQLSRQYS
PSNFVEPPPPPPPRCSSTPPPPPPPHAPYSQPNVPTNMQQMLKRMSPAPVVPTRSPASGA
PGSVGAATTSVNPPQRGTSPVASSNNNSSSRQPMIVQNGPQVQQQLTQQIQALSIYQTGN
GSASAQVEPPPPYPVPSSSSAGPVQPPSYSASIQNRQSPTQSQQDYRKSPSSGIYSGPTS
AGSPSPITVSTISPNATQTSMARPTPLQAWGARQAKTQPPIIMQSVKSTQVQKPVLQTAI
APTSPQPISTTSNTPPPPPSYATSIQQKQQQQQQQQQQQQQQPPPAYPPVNNVAAASASI
GVPTTEPPSYATTMQALAAQRGMHHPPPPYGTPTENSTAMSTVESSSAPRSSPVAHHPPL
QRKYSPADNCGQHAVETPPLPPVASTSVSTRSNNHSSLPDSGNSSGKSGSGGGGGGSGGS
SPSSYKIKHQSPIPERKHMSKEKEEERRDCKVRNYSPQAFKFFMEQHVENVLKSHKQRLY
RRLQLETEMAKIGLSEEAQCQMRKMLSQKESNYIRLKRAKMDKSMFTKIKPIGVGAFGEV
TLVRKIDTNQFYAMKTLRKADVLNRNQVAHVKAERDILAEADNEWVVKLYYSFQDKDNLY
FVMDYIPGGDLMSLLIKFGIFKEPLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRD
GHIKLTDFGLCTGFRWTHNSKYYQQNGHGKQDSMDPADDWNKECRCTQLKPLERRRHREH
QRCLAHSLVGTPNYIAPEVLQRTGYTQLCDWWSVGVILYEMLVGSPPFLANTPAETQYKV
INWETTLHIPKQANLSPEGMDLILKLCVGADRRLGKNADEVKSHPFFANIDFEKGLRRQV
APHIPRIQYPTDTSNFDPVDPDKLRNSESSDSNKSDELLDNGKPFHGFFEFTFRRFFDDG
GGPSYPGRISLDDNDNQGPVYV
NT seq 3309 nt   +upstreamnt  +downstreamnt
atgaatccacctgcggtcagcaaactgagcactcgcggctccggttatcaccagaaggcg
ttagctgagatccgcaactccttgctgccgttcgcaaatatcggcggggctggtgaggtg
ggctctagcgccgccagcactatctccacactatccacgactagtggcatcagctccgcc
tctggtctgagcggcctctccggcgcctcaggctcgactgtcgataaaccggaccaacgg
caggcgttgggtcaactgctcgccatggggtactcagaagagataggagtacgcgccctc
aagctctgcggctggcggctggacgcggcgatcgagttcttgaaacaggctcaaggcggg
gaatctctgaacgggctcggcaaactgaacaccaagctcatccggaagccgagtctcgag
cgagaactgagcctgcagcgcggcagtcccgcattggacagcggtgcgggtagctcgcgg
tcggacagtccgcgtctcaccgagctcagtccgcaccctcagctgagccgtcaatattcg
ccgagcaacttcgtggaaccgccgccgccaccgccgccgcgatgcagctcgacaccgccg
ccacctccgccgccccatgccccgtacagtcagcccaatgtacctacgaacatgcagcag
atgctgaaacggatgtcaccggcaccggtggtgccgacgaggtcaccggccagcggtgcg
cccggcagcgtcggtgccgcgaccacatcggtgaatccgccgcagcggggcacgagcccg
gtggcgagcagcaacaacaactccagcagccgtcagccgatgatcgtgcagaacggcccg
caggtgcagcagcagctgacgcagcaaatacaggcgctcagcatttaccagacgggcaat
gggagtgcgagcgctcaggtcgagccgccgccgccgtaccccgtgccgtcttcatcctcg
gctggcccggtgcagccgccctcttacagcgcctccatacagaatcggcagagcccgacg
cagtcacagcaggattaccgcaagagtccgtcgtcgggcatctactccggtccaacatcc
gccggctcaccgagtcctatcaccgtgtccaccatctcgccgaatgccacgcaaacgtcg
atggcgaggccaacgccgctgcaggcgtggggtgcgcgccaggcgaagacgcagccgccg
atcatcatgcagtcggtgaagagtacgcaggtgcagaagccggtgttgcagaccgccatc
gcgcccacgtcgccgcagccgatatcgacgaccagcaacacgccaccgccgccgccttct
tacgccacgtcgatccagcagaagcaacagcagcagcagcagcaacaacaacaacaacaa
caacaaccaccacctgcgtatccgccggtcaataacgtcgccgcggcatccgcgagtatc
ggcgtgccgaccaccgaaccgcccagctacgccacgacaatgcaagcgttggccgcgcaa
cgcggcatgcatcatccaccaccaccttacggcaccccaacggagaacagcacggcgatg
tccacggtggagagcagtagcgcgccgcgatcctccccggtggcgcatcacccgccgctc
cagaggaagtattcgccggccgacaattgcggccagcacgcagtggagactccgccgttg
ccgccggtcgcctcgacctccgtctccacgagaagcaacaaccattcgtctttgcccgac
agcgggaacagtagtggcaagagcggcagcggcggcggcggcggcggtagcggcggctcg
tcaccctcgtcctacaagatcaagcatcagtcaccgatacctgagcgcaagcatatgagt
aaagagaaggaggaggagcgtagggactgcaaggtgaggaattactcgccgcaagcgttc
aagttcttcatggagcagcatgtggagaatgtgctcaagtcgcacaagcagcgtctctac
cggcgcctgcagttagagacggagatggcgaagattggcctgagcgaggaggcgcagtgt
cagatgcggaagatgctgtcgcagaaggagtccaattacatacggttgaaacgggcgaag
atggacaagtcgatgttcacgaagatcaagccgatcggcgtgggtgcgttcggcgaggtc
acgctcgtcaggaagatcgacacaaatcagttctacgcgatgaagacgttgcgcaaggcc
gatgtgctgaatcgcaaccaggtcgctcatgtgaaggccgagcgggatatcttggccgag
gccgacaacgagtgggtcgtcaagctctattactcgttccaagacaaggacaatctgtac
ttcgtgatggattatatacccggcggcgacctcatgtcgctgctcatcaaattcggcatc
ttcaaggagccgttggcgagattttatatcgctgagctcacgtgtgcggttgagagtgta
cacaagatgggattcattcacagagacattaaacccgataatatcctgatcgatcgggac
ggccatatcaagctgaccgatttcggcctctgcacgggattccgctggactcacaattcg
aaatattaccagcaaaatggtcatggtaaacaagattcaatggacccagctgatgattgg
aacaaggagtgtcgatgcacacagctgaagccgctagaacgtaggcggcatagggaacac
cagaggtgtctggcacactctctagtgggcacgccgaactatatcgctccggaagtctta
cagcgcacgggatacacgcaattgtgcgactggtggagtgtgggagtgatcttgtacgaa
atgttagttggttctccaccgtttcttgccaatacgcccgctgaaactcaatacaaggtt
attaattgggaaacaacgcttcacatcccgaagcaggctaatctatcgccggaaggtatg
gatctaatattgaagctttgcgtgggcgcagatcgtcggttaggtaagaacgcggatgag
gtcaagagtcacccgtttttcgcgaatattgatttcgagaagggtctgcgtcgtcaagta
gccccgcacataccccgaatacagtatcctaccgacacgagtaacttcgaccccgtggac
cccgacaagctgcgtaactccgagtcgtccgactccaataagtcggacgagctgttggat
aacggcaagccgtttcacggcttcttcgaattcacgttcagacgcttctttgacgacggc
ggcggcccctcgtatccaggccggataagcttggacgataatgacaatcaaggccccgtc
tacgtatga

DBGET integrated database retrieval system