KEGG   Halanaeroarchaeum sulfurireducens HSR2: HLASF_0332Help
Entry
HLASF_0332        CDS       T03927                                 

Definition
(GenBank) response regulator receiver protein
  KO
K07662  two-component system, OmpR family, response regulator CpxR
Organism
hsu  Halanaeroarchaeum sulfurireducens HSR2
Pathway
hsu01503  Cationic antimicrobial peptide (CAMP) resistance
hsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HLASF_0332
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    HLASF_0332
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:hsu02022]
    HLASF_0332
Two-component system [BR:hsu02022]
 OmpR family
  CpxA-CpxR (envelope stress response)
   HLASF_0332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HalX DUF2520 BAR_3 MtrG PCRF S_4TM
Motif
Other DBs
NCBI-ProteinID: AKH96839
UniProt: A0A0F7PB19
LinkDB All DBs
Position
complement(322448..323002)
Genome map
AA seq 184 aa AA seqDB search
MTDEPATVLVVDDETNITTLFDAWLDGEYAVRTANSGSEALEQIDESIDVALLDRRMPGI
SGDELLEEIRDRDLDVRVAMVTAIDPDFDVLEMGFDDYLTKPVSREDLEDLVDALESRKH
YAEEMQEYYSLAAKRAALESSKPAAELVESEEYDELLEKLDEIETDLDGKLSGEEDFVSA
FQDL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgaaccggccaccgtgctggtcgtcgacgacgagacgaacatcaccacgctg
ttcgacgcgtggctcgatggtgagtacgccgtgcgcacggcgaactccggtagcgaggcc
ctcgagcagatcgacgaatcgatcgacgtggctctcctcgaccggcggatgcccggcatc
tctggcgacgaactcctggaggagatccgcgatcgcgacctcgacgttcgtgttgccatg
gtgaccgcgatcgatcccgacttcgacgtcctggagatgggtttcgacgactacctcacc
aagcccgtctcgcgagaggacctcgaggacctcgtcgacgcgctggagtcccgcaaacac
tacgccgaggaaatgcaggagtactactcgctggccgcgaaaagggcggccctcgagtcc
tcgaagcccgcggccgaactggtcgaaagcgaggagtacgacgaactccttgagaaactc
gacgagatcgaaacggacctcgacgggaagttgtccggggaggaagacttcgtttccgcg
ttccaggacctctag

DBGET integrated database retrieval system