KEGG   Halanaeroarchaeum sulfurireducens HSR2: HLASF_0648Help
Entry
HLASF_0648        CDS       T03927                                 

Gene name
smc1
Definition
(GenBank) chromosome segregation protein SMC
  KO
K03529  chromosome segregation protein
Organism
hsu  Halanaeroarchaeum sulfurireducens HSR2
Brite
KEGG Orthology (KO) [BR:hsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsu03036]
    HLASF_0648 (smc1)
Chromosome and associated proteins [BR:hsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    HLASF_0648 (smc1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N SMC_hinge AAA_15 AAA_23 AAA_21 AAA_13 DUF1664 Spc7 AAA_29 Laminin_I ATG16 Atg14 SHE3 Fib_alpha TMPIT DUF3584 Laminin_II Exonuc_VII_L FlaC_arch DUF4200 DUF724 ABC_tran GAS
Motif
Other DBs
NCBI-ProteinID: AKH97144
UniProt: A0A0F7PBZ7
LinkDB All DBs
Position
complement(625932..629504)
Genome map
AA seq 1190 aa AA seqDB search
MYIDEIVLDNFKSFGRTTRIPFYQDFTTISGPNGSGKSNIIDAILFALGLARTRGMRAEK
LTDLIYNPSHEDGDGAGPDEANVEVILNNEDGTLSRSQVVNAAGSEDVGDVDRIRVKRRV
KRTEDNYYSYYYLNGRSVNLSDITDLLAQAGVTPEGYNVVMQGDVTGIIQMTPHERREIV
DEIAGVAEFDQKKADAFEELDVVEDRIGEAELRIEEKRNRLDTLEEERETALEYQGLRDE
KGEYESFLDAAELEEKREDLAATESDIEDRAAELEDLQAELDERRGTVLRLEEDLEDLNA
EIERKGEDEQLAIKREIEEVKGEISRLEDGIATAEERIEEAEQARRQAFVQIDRKQEKIE
EIEAEIREIKVEKSSLAADKREKESELASVQQEIDDIDTEYEERKEALEENKDALETAKS
ARNDLQREKDRLLDEARRRSNDIDEARDNVTAATETIEELDARIEDLETELEKATKNEEQ
IAEVVEDLKREKAERQDDLDDVEDDLGAAREEYARLEAQADENGDSSYGRAVTTILDADI
DGVHGTVAQLGGVEERFATACETAAGGRMANVVVDDDGVGQRGIDYLKSRNAGRATFLPL
TEMYERSLPTAPNEPGVIDFAYNLVDFDERYAGVFSYVLGDTLVVEDLETARDRMGDRRL
VTLDGDLIETSGAMTGGSRSGSRYSFAKTGKGQLERVAERIQRLEDKRADIREDVRSIES
RLEDAREKRAAAADQVRDLEAEIDRVAGEREETEQRIESMESRIESLEAEREDVDERMQE
LDADIQEKTEEIEAIQSDIEAIEAELADSRIPELAAKREEIQSEIGTIEDRMDDLDGERN
SLELEKQYAEEAVDDLHDEVESAQNKKAAQQERIDDLRDEIDEKEALLEEKREAVAELES
ELSDLKAEREELKDELDEASSHRDEKKQEVERVSNRLESLRRAAERLRAEIEELSETVEE
YDPEEIPDLDEVEENIERLDEQMAALEPVNMKAIEEYNRVETTLNDLEERRDELTEERDA
IEERIETYDQLKKETFMEAYEAINEQFEQIFQRLSNGTGELVLENPADPFDGGLTMRAQP
GDKPIQRLDAMSGGEKSLTALALIFAIQRYNPAPFYALDEVDAFLDAANAERVGEMVDEL
ASEAQFVVVTHRSAMLDRSERAIGVTMREDNVSAVTGIDLAGQRGASADD
NT seq 3573 nt NT seq  +upstreamnt  +downstreamnt
atgtacatcgacgagatcgtcctcgacaatttcaagagcttcgggaggaccacgaggatc
ccgttctatcaggatttcacgaccatcagtggcccgaacggctcggggaagtccaacata
atcgacgccatcctgttcgcgcttggtctggcgcggacccgcgggatgcgcgccgagaag
ctaacagacctgatctacaatcccagccacgaggacggcgatggcgccggtcccgacgag
gccaacgtcgaggtcattttgaacaacgaagacgggacgctgtcccgatcgcaggtcgtc
aacgcggccgggtccgaggacgtcggagacgtcgatcggatccgggtcaagcgccgggta
aaacggaccgaggacaactactactcgtattactatctcaacggtcgctcggtcaacctc
tcggacatcaccgatctgctcgcgcaggcaggggtgacacccgagggatacaacgtcgtg
atgcagggcgacgtgacgggtatcatccagatgaccccacacgagcgacgcgagatcgtc
gacgaaatcgccggggtcgccgagttcgaccagaaaaaggccgacgcattcgaggaactc
gacgtcgtcgaggaccgcatcggcgaggccgagttacgcatcgaggagaaacgcaaccgc
ctcgataccctcgaggaggagcgcgagaccgccctcgagtaccagggactccgggacgag
aaaggggagtacgagagctttctcgacgcggcggaactcgaagagaaacgcgaggatctg
gcggcgacggaaagcgacatcgaggatcgggccgcggaactcgaagacctccaggcggaa
ctcgacgagcggcgagggacggtccttcgcctcgaagaggacctcgaggacctcaacgcc
gagatcgagagaaaaggcgaagacgaacagctcgcgatcaaacgggagatcgaggaggtc
aaaggcgagatctcccggctggaagacgggatagcgaccgccgaggagcgcatcgaggag
gccgagcaggcgcgccgacaggcgttcgtccagatcgatcgcaaacaggagaagatcgag
gagatcgaagcggagatccgagagatcaaagtcgagaagtcctcgctcgcggccgacaaa
cgtgagaaggaatcggaactggcgtcggtccaacaggagatcgacgacatcgacaccgag
tacgaggaacgcaaagaggccctcgaggagaacaaagacgccctcgagacggcgaaaagt
gcgaggaacgaccttcaacgcgagaaggaccggctgctggacgaggcccgtcgacgctcg
aacgacatcgacgaggcgcgggacaacgtcacggcggcaacggagacgatcgaggaactc
gacgctcggatcgaagacctcgagaccgagctcgagaaggcgaccaagaacgaagagcag
atcgccgaggtcgtcgaggacctgaaacgggagaaggccgagcggcaggacgacctcgac
gacgtggaagacgatctgggcgcggcccgcgaggagtacgctcgcctcgaagcacaggcc
gacgagaacggcgacagttcgtacggccgagccgtgacgacgatcctcgacgccgacatc
gacggggtccacgggaccgtcgcccagctcggcggggtcgaagagcgctttgcgaccgcc
tgcgagacggccgccggggggcgaatggcgaacgtggtcgtcgacgacgacggggtcggc
cagcgcggtatcgactacctcaaatcgcgcaatgccggtcgcgcgaccttcctgccgcta
accgagatgtacgagcgatcgcttccgaccgccccgaacgagccaggcgtcatcgacttc
gcgtacaacctcgtggacttcgacgagcgatatgccggcgtcttctcgtacgtcctcggg
gacacgctcgtggtcgaggacctcgagaccgcccgggatcgcatgggggatcggcgactc
gtcacgctcgatggcgacctcatcgagacgagtggggcgatgaccggtggcagccgatcc
ggttcgcggtactccttcgcgaagaccgggaaggggcaactcgagcgggtcgccgagcgc
atccagcgcctcgaagacaaacgggcggacatccgcgaggacgtccggtccatcgagagt
cgactggaggacgcccgggagaagcgcgccgcggctgcagaccaggttcgcgatctggag
gcagagatcgaccgggttgcgggcgagcgcgaggagaccgagcagcgcatcgaatcgatg
gaatcccgcatcgagagcctggaagccgaacgggaggacgtggacgagcgcatgcaggaa
ctcgacgcggacatccaggagaaaaccgaggagatcgaggcgatccagtccgacatcgag
gcgatcgaggcggagctcgcggattcgcggatcccggaactcgccgcgaaacgcgaggag
atccagtcggagatcgggaccatcgaggatcggatggacgatctcgacggcgaacgcaac
agcctcgaactcgaaaaacagtacgccgaggaggccgtcgacgacctccacgacgaggtg
gaatccgcccagaacaagaaggccgcccagcaggagcgcatcgacgatctgcgcgatgag
atcgacgagaaggaggcactcctcgaggagaaacgcgaggccgtcgccgaactcgaatcc
gagctgtcggacctcaaagccgaacgcgaggagctcaaagacgaactcgacgaggcctcg
tcgcaccgcgacgaaaaaaagcaggaggtcgagcgcgtctcgaaccgcctcgagagcctg
cgacgggccgccgagcgccttcgggcggagatcgaggagctctcggagacggtcgaggag
tacgaccccgaggagataccggacctcgacgaggtcgaggagaacatcgaacgactcgac
gagcagatggccgccctggagccggtgaacatgaaggccatcgaggagtacaaccgggtc
gagacgaccctcaacgacctggaggagcgcagagacgaactcaccgaagagcgcgacgcc
atcgaggaacgtatcgagacctacgatcagctgaaaaaggagacgttcatggaggcctac
gaggcgatcaacgaacagttcgagcagatcttccagcgcctctcgaacggcaccggcgaa
ctcgtgctcgaaaacccggccgacccgttcgacggtgggctcaccatgcgggcccaaccg
ggagacaaacccatccagcgcctggacgcgatgtcgggcggcgagaagtcgctgaccgcg
ctcgcactcatcttcgccatccagcgatacaaccccgcacccttctacgcgctcgacgag
gtcgacgcgttcctcgacgcggccaacgccgagcgcgtcggagagatggtcgacgaactc
gcgagcgaggcccagttcgtcgtcgtcacccaccgatctgccatgctcgatcgctccgag
cgtgccatcggcgtcacgatgcgggaggacaacgtgagcgcggtcaccgggatcgacctg
gccggccagcgaggtgcgagtgcggatgactga

DBGET integrated database retrieval system