KEGG   Halanaeroarchaeum sulfurireducens HSR2: HLASF_1514Help
Entry
HLASF_1514        CDS       T03927                                 

Gene name
glpA
Definition
(GenBank) anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hsu  Halanaeroarchaeum sulfurireducens HSR2
Pathway
hsu00564  Glycerophospholipid metabolism
hsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HLASF_1514 (glpA)
Enzymes [BR:hsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     HLASF_1514 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_oxidored DAO_C Pyr_redox_2 DUF3606 FAD_binding_3 NAD_binding_8 3HCDH_N ApbA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AKH97993
UniProt: A0A0F7PF93
LinkDB All DBs
Position
1466102..1467730
Genome map
AA seq 542 aa AA seqDB search
MVVGGGATGTGITRDLAMRGVDVTLVERDRLAFGTSGRMHGLLHSGARYAVSDPDTARHC
HDENRTLRDIAAHCVEDTGGLFVQLPEDDAEYFDRKQRACQEAGIPTAEIDADRARREEP
LLSSAVERALRVPDAAIDPFGLVAANAASAADHGATIRTHTPVTDVLVEGGAVVGVAIDD
ESTAGRSTIRAEQVVNATGPWAGDLAAMAGVDVPMRPAKGAMMVTNVRQVDTVINRCRPR
AEGDILVPHGTTAILGTTDREIEDPDAYEEESSEVTHLVEELSEMVPALAEARPLRAYWG
VRPLFAPDGQEDTTADSRDFAILDHQERDGIGGFTTVVGGKLTLYRLMAERVADLIAGRL
GVDAPCRTASEPLPGSDGAVDVRTVMQRFDLRSQVAHRTADRLGDRTDPVLEGSESADRR
VLCECEAVTRAEVRDAIEAVGPDIEAIRNRTRAAMGTCQGTRCGHRLASEIAHVHGPEAG
MDALDDLTAERWQGQRHVAEGRLGQLALAYSIHGGTYNRARNPEAFRAVEYDAFGGGDGD
DT
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgtcggtggtggcgcgaccggaaccggcatcactcgcgacctggcgatgcgaggg
gtcgacgtgacgctcgtcgagcgggatcgactcgcgttcggtacctcggggcgaatgcac
gggctcctccacagcggcgcccggtacgccgtctccgacccggacaccgccaggcactgc
cacgacgagaaccggacgcttcgcgacatcgccgcccactgtgtcgaggacacgggcggg
ctgttcgtgcaattgcccgaggacgatgcggagtacttcgatcgaaagcagcgggcctgc
caggaggcggggattccaacagcagagatcgatgccgaccgcgcccgccgcgaggagccg
ttgctctccagtgcggtcgaacgggcgctccgggttcccgacgccgccatcgatccgttc
ggactcgtcgccgcgaacgcggcgagcgcggcggaccacggagccaccattcgaactcac
acccccgtgaccgacgtcctcgtggagggcggggccgtggtgggcgtcgcgatcgacgac
gaatctacggcgggccgatcgacgatccgggcggagcaggtcgtgaatgccacgggaccc
tgggccggcgaccttgcggcgatggccggcgtcgacgtcccgatgcggccggcgaagggg
gcgatgatggtgacgaacgtccgccaggtggacaccgtgatcaaccgctgtcggccacgg
gcggagggcgatatcctcgtgccccacgggacgacggcaatactgggaacgaccgaccgg
gagatcgaggatccggacgcctacgaggaggagtcctcggaggtaacccacctcgtcgag
gaactctccgaaatggtgccggcgttggccgaggcgcgtccgctccgggcgtactggggc
gtgaggccactgttcgctccggacggtcaggaagacaccaccgccgattcgcgggacttc
gccattctggaccaccaggaacgcgacggcattggtggcttcaccacggtcgtcggcggg
aaactgacgttgtaccgcttgatggcagagcgcgtcgcggacctgatcgccggacgattg
ggggtggacgccccctgtcgaaccgcgagcgagcccctccccggcagcgacggggcggtc
gacgtccgcactgtcatgcagcgattcgacctccgaagccaggtggcccaccggacggct
gatcgcctcggtgacaggacggatccagtcctcgagggctccgagagcgcggaccgaagg
gtcctctgcgagtgcgaggccgtcacgcgggcggaggtcagggatgccatcgaggccgtc
ggccccgacatcgaggccatcaggaatcgcactcgggcggcgatggggacgtgtcagggc
acgcgctgtgggcatcggctcgcgagcgagatcgcccacgttcacggtccggaggcgggt
atggacgccctcgacgacctcacggccgagcgatggcagggccagcgccacgtcgccgag
ggacggctgggccagctcgcgctcgcctactcgattcacggcgggacctacaaccgcgct
cgcaaccccgaggcgttccgcgcggtggaatacgacgcgttcgggggaggtgacggcgat
gacacgtga

DBGET integrated database retrieval system