KEGG   Hymenobacter swuensis: Hsw_0324Help
Entry
Hsw_0324          CDS       T03055                                 

Definition
(GenBank) putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hsw  Hymenobacter swuensis
Pathway
hsw00473  D-Alanine metabolism
hsw01100  Metabolic pathways
hsw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hsw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Hsw_0324
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Hsw_0324
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hsw01011]
    Hsw_0324
Enzymes [BR:hsw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Hsw_0324
Peptidoglycan biosynthesis and degradation proteins [BR:hsw01011]
 Precursor biosynthesis
  Racemase
   Hsw_0324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AHJ95919
UniProt: W8ES20
LinkDB All DBs
Position
363257..365758
Genome map
AA seq 833 aa AA seqDB search
MLQFSDLPALTGGTLLQLPATPAAIQRLLLDSRRVQTPADSLFLALRGPQHDGHRYLPEL
YRAGVRQFLVQDDVPLADFPEAGFLRVPDTLAALQALAAHHRRRFPIPVFGITGSNGKTI
VKEWLAQLLSPDELICKSPRSYNSQVGVPLSVWELTASHTLGIFEAGISEPGEMARLVRI
IQPTLGIFTNLGTAHDAGFASPAEKVTEKMRLFEQVDTLFYCADHELIHAAARRQLSPAR
TTRVAWTRQRARFDAQEADLLITMQEAAADRAVVRVERARPRPQEHTFTLPFADEPSVEN
ALHGLAVLLWRQVPPTEIQQRLDRLQPVAMRLEMKQALHDCYVLDDTYNNDLAGLRLALD
ALARQARRGRRTLILSDVLESGLAGAELYARVAALLPAHGVERLIGIGPDISRHHAAFAG
LQAEFYPDTAAFLAAFQPEQFRQELILVKGARRYGFERIVAAFQQKIHGTVLEVNLDALV
HNLNFYRRRLQPGVKLMVMVKAFAYGSGSAEVANLLQFHRADYLAVAYADEGVDLRQSGI
SLPLMVMNPAPDAFQKLRQYHLEPEIYSFERLHDYLAAAREAAMPAIHLKLDTGMRRLGF
AEEDLPELCRLLHENAAHLRVASALTHLAGADEEQHNSFSREQLAAFARMTPQLEAALGY
PILQHALNSAGIVRFPEDQHSLVRLGIGLYGVEASGQEPDALRSVSTLRTTISQIKTLPA
GQTVGYGRRGQATDHERRIATLAIGYADGYDRRFGNGAGEVLIRGQRAPIVGNVCMDMCM
ADVTHIADAQAGDAAVVFGENLPLTELAARIGTIPYELLTNVSERVKRVFVAE
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgctccagttctccgacctgcccgcgcttaccggcggcaccctgctccaacttcccgcc
accccggcagccattcagcggctgctgctggatagccgccgcgtgcaaacccccgccgac
agcctgttcctggccctgcgcggcccccagcacgacggccaccgctacctgcccgagttg
taccgggccggcgtgcgccagtttttggtgcaggacgacgtgccgctggccgactttcct
gaggccggtttcttacgggtgcccgataccctggcagccctgcaggcgctggcggcccac
caccgccgccgcttccccatcccggtgttcggcattaccggctccaacggcaaaaccatc
gtgaaggagtggctggcccaactgctgagccccgacgagctgatctgtaagagtccgcgc
tcctacaactcccaggtgggcgtgcccctgagcgtgtgggagcttaccgccagccacacg
ctgggcatcttcgaggccggcatttccgagcccggcgagatggcgcggctggttcgcatc
atccagcccacgctgggcatcttcaccaatctgggtacggcccacgatgccggtttcgcc
tcccccgccgaaaaggtgacggagaagatgcgcctgtttgagcaggtggataccctgttc
tattgcgccgaccacgagctgattcacgccgccgcccgccgccagctcagccccgcccgc
accacccgcgtggcctggacgcgccagcgcgcccgcttcgacgcccaggaagccgacctg
ctcatcactatgcaggaagccgctgccgaccgggccgtggtgcgggtggagcgcgcccgg
ccccgcccccaggagcacaccttcacgctgcctttcgccgatgagccctccgtagaaaac
gccctccacggcctggcggtgctgctgtggcggcaggtgccccccaccgaaatccagcag
cgcctcgaccggctccagcccgtggccatgcgtctggagatgaagcaggctttgcacgac
tgctacgtcctcgacgatacctacaacaacgacttggccggcctgcgcctcgccctcgat
gccctggcccggcaagcccgccggggccgccgcaccctcattctctccgatgtgctcgaa
tcgggcttagccggggccgaactgtacgcgcgggtggcggctttgctgccggcccacggc
gtggagcgcctcatcggcatcggccccgatatcagtcggcaccacgcggcgtttgcgggc
ctgcaggctgaattctaccccgacacggccgcgtttctggccgctttccaacccgagcag
ttccgccaggagttgattctggtgaaaggggcccgccgctacggcttcgagcggattgtt
gccgccttccagcagaaaatccacggcacagtgctggaagtaaacctcgacgcgctggtg
cacaaccttaacttctaccgtcgccgcctgcagcccggcgtgaagctgatggtgatggtg
aaggcctttgcctacggcagcggctcggccgaagtcgccaacctgcttcagttccaccgc
gcagactacctggccgtggcctacgccgacgagggcgtggacctgcgccagagcggcatc
agcctgccgctgatggtgatgaacccggctcccgacgccttccagaagctgcgccagtac
cacctggaacccgaaatctactccttcgagcgcctgcacgactacctggccgccgcccgc
gaggccgccatgcccgccatccacctcaagctcgataccggcatgcgccgcctgggcttc
gccgaggaagacctgcccgagctgtgtcggctgctgcacgaaaacgccgcccacctgcgc
gtagccagcgccctcacccacttggccggagccgacgaggagcagcacaacagcttctcg
cgggagcagctggccgccttcgcccgcatgacgccccagctggaggcggccctgggctac
cccattctccagcacgccctcaactcggccggcattgtgcggtttccggaggaccagcac
agtctggtacgccttggcatcggcctctatggggtggaagccagtggccaggagcccgac
gcgctgcggtctgtgagcaccctgcgtaccaccatttcccagatcaaaaccctgccggcg
ggccagacggtgggctacggccgccgcggccaagccaccgaccacgagcggcgcattgcc
accctggccatcggctatgccgacggctacgaccggcgcttcggcaacggggcgggcgag
gtgcttatccgtgggcaacgggcgcccatcgtaggcaacgtgtgcatggacatgtgcatg
gccgacgtgactcacattgccgacgctcaagccggcgacgcggccgtggtattcggcgaa
aacctgcccctcacggagctggccgcgcgcatcggcaccattccgtatgagttgctgacc
aacgtaagcgagcgggtgaagcgagtgttcgtagcagaatag

DBGET integrated database retrieval system