KEGG   Hymenobacter swuensis: Hsw_0514Help
Entry
Hsw_0514          CDS       T03055                                 

Definition
(GenBank) manganese/iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hsw  Hymenobacter swuensis
Brite
Enzymes [BR:hsw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Hsw_0514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AHJ96109
UniProt: W8ESI4
LinkDB All DBs
Position
complement(576968..577576)
Genome map
AA seq 202 aa AA seqDB search
MAFELPQLPYAYDALEPHIDAQTMEIHHGKHHQAYVTNLNNAVAGTELEGKSLEDLLQNI
ASAPAAVRNNGGGHWNHSFFWQILGPNGGGTPTGAVGEAINQAFGSYEKFKEEFTKAATT
RFGSGWAWLCKQADGSVQICSTPNQDNPLMPDTGCKGTPVLGLDVWEHAYYLKYQNRRPD
YIAAFFNLINWDEVNKRFADAA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaactgccccaactgccctacgcctacgatgccctggagccgcacattgat
gcgcaaaccatggaaatccaccacggcaagcaccatcaggcctacgttactaacctcaac
aacgccgtagccggcactgaattggaaggcaagagtctggaagatttgctgcagaacatt
gcctcggctccggcagccgtacgcaacaacggcggtggccattggaaccactcctttttc
tggcagattctgggccccaacggtggtggtacccccaccggcgctgtcggcgaagccatc
aaccaggcattcggcagctacgagaaattcaaggaggaattcaccaaggctgctactacc
cgtttcggctcgggctgggcgtggctgtgcaagcaggccgacggctcggtacaaatctgc
tccacgcctaaccaggataatcccctcatgcccgacaccggctgcaaaggtactccggta
ctgggcctcgacgtgtgggagcacgcctactacctcaagtatcagaaccgtcgccccgat
tacattgccgccttcttcaacctcatcaactgggacgaagtaaacaagcgtttcgcggac
gccgcgtaa

DBGET integrated database retrieval system