KEGG   Hymenobacter swuensis: Hsw_0919Help
Entry
Hsw_0919          CDS       T03055                                 

Definition
(GenBank) putative ribonuclease BN
  KO
K07058  membrane protein
Organism
hsw  Hymenobacter swuensis
Brite
KEGG Orthology (KO) [BR:hsw00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Hsw_0919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: AHJ96514
UniProt: W8ETP4
LinkDB All DBs
Position
1035651..1036619
Genome map
AA seq 322 aa AA seqDB search
MRLPVRRYHIPDVRRRRSYRRAIVFLKQLRFARGRASVYDVVDRLLQEIRLDGIAKRASY
MAFNLTIAIFPTIIFLFTLIPYIPVPNLNVDILQFLADLIPREMYVAVSGTIEDIVNIPH
GGLLSFGFATALVLSSNGIMALLDAFEKKYPSFKKRTYLRKRVIATLLTVVLSSVLLFAV
AGIFFGTYIIDALVYHEIVPEAMTDQLTGVLRYGSVVSLFLLTTCLVYYYVPPVHDKWPF
ISAGAVVATLLIFLVSFLFILYVKIFDSYNHFYGSIGTLVGFMVWLDFVCMTLILGFEIN
VSIDAVTGRLKRPAALAKAVAQ
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcttccggttcgccgttatcatattcccgatgtgcgccgccgccgcagctaccgg
cgcgccatcgtgtttctgaagcagctccggtttgccagagggcgcgcctccgtgtatgac
gtggtggaccggctgctgcaggaaatccggctggatggcattgccaagcgggccagctac
atggccttcaacctcactattgccatcttccccaccattatcttcctgttcacgctcatc
ccctacattccggtgcccaacctgaatgtggacatcctccagtttctggccgacctcatt
ccccgggaaatgtacgtggccgtttccggcaccattgaggatatcgtgaacattccccac
ggcgggctgctgtccttcggttttgccacggccctagtgctgagttccaacggcatcatg
gccctgcttgatgcgtttgagaagaaatatccctcgttcaagaagcgtacctatctgcgc
aagcgggttattgccacgctactcacggtagtcctgtcgtcggtgctcctgtttgcggtg
gcaggcatctttttcgggacctacatcattgatgcgctggtgtaccacgaaatcgtgccc
gaagccatgaccgaccagctgaccggcgtgctgcgctatggctcggttgtcagcctgttc
ctgctcacaacctgcctggtatactactacgtgccgccggtgcacgataaatggccgttc
atctcggctggggcagtggtggccacgctgctcattttcctggtgtccttcctgtttatc
ctctacgtcaagatttttgacagctacaaccacttctatggctccatcggtacgctggtg
ggcttcatggtgtggctggatttcgtgtgcatgaccctgattctgggcttcgagataaac
gtgagcattgatgccgtaacggggcggctgaagcggccggcggcccttgcaaaggctgtg
gctcaatag

DBGET integrated database retrieval system