KEGG   Hymenobacter swuensis: Hsw_2700Help
Entry
Hsw_2700          CDS       T03055                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
hsw  Hymenobacter swuensis
Pathway
hsw00010  Glycolysis / Gluconeogenesis
hsw00052  Galactose metabolism
hsw01100  Metabolic pathways
hsw01110  Biosynthesis of secondary metabolites
hsw01120  Microbial metabolism in diverse environments
hsw01130  Biosynthesis of antibiotics
Module
hsw_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:hsw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hsw_2700
   00052 Galactose metabolism
    Hsw_2700
Enzymes [BR:hsw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Hsw_2700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AHJ98295
UniProt: W8F993
LinkDB All DBs
Position
complement(3044135..3045337)
Genome map
AA seq 400 aa AA seqDB search
MVASGLASLLLTAACQQSDKATTAETGATSAAASSDSTQSSSATMPTSSVFGKLADGTEV
QLYTLTNAHGLKATITTYGGTLTSLLVPDKDGKMGDVVLGFDDLAGYLAPVYKQEGPYFG
ALIGRYGNRIAKGKFTLDGKQYSIPTNNAPNTLHGGKEGFDKKLWTAAPGTSAEGQTLTL
TYQSKDGEEGYPGTLTVKVVYTLTEGDALRLDYTATTDKPTVLNLTNHSYFNLNVASGKG
ILDHELTLNADRFTPVDNTLIPTGVLQPVQGTPMDFRQPHRIGERIKQVPGAAPGGYDHN
WVLADTQRRSPEKAATVYEPTTGRVMDVYTDQPGVQFYSSNFLKGNLKGKGAVTYNQYAG
LCLETQHFPDSPNRPSFPSTELKPGETFHSTTEYRFNTRK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
ttggtggccagtgggctggccagcctgttgctcacggccgcctgccagcagtctgataag
gccactaccgccgaaactggtgctacatctgccgccgcttcttccgattccacccagtct
tcttccgcaaccatgcctacttccagcgtctttggcaaactggccgatggtaccgaggtg
caactctacaccctcaccaacgcccacggcctaaaggccaccatcacgacctacgggggc
acgctcaccagcctgctcgtgcccgataaggatggcaagatgggggatgtagtgctgggt
ttcgatgacctggcgggctacttggccccggtgtacaagcaggaaggcccctactttggg
gccttgattgggcgctacggcaaccgcattgccaagggcaagttcaccctcgacggtaaa
cagtattccatccccaccaacaacgcgcccaacaccctgcacgggggcaaagaaggtttc
gacaaaaagctgtggacggccgcgcccggcacctcggccgaggggcagacgctcacgctc
acctaccagagcaaggacggggaggaaggctaccccggcacgctgacggtaaaagtagtg
tacaccctgaccgagggcgacgcgctgcgcctcgactacacggccaccaccgacaagccc
acggtgctcaacctcaccaaccacagctacttcaacctgaacgtggcctccggcaaaggc
atcctggaccacgagctgacgctgaacgccgaccggtttacgcccgtggataacacgctg
attccgaccggggtgctgcagccggtgcaaggcacgcccatggattttcgccagccccac
cgcatcggggagcgaattaagcaagtgcccggcgcggcccccggtggctacgaccacaac
tgggtgctggccgacacgcagcgccgcagtccggaaaaggcggccaccgtgtacgagccc
accaccggccgcgtgatggacgtgtacaccgaccagcctggtgtacagttctattcctcc
aactttctgaaaggcaacctgaaagggaaaggcgccgtgacctacaaccagtacgccggc
ctctgcctggaaacccagcacttccccgattcgcctaaccggcccagcttcccgagcaca
gagctgaagcccggtgaaaccttccactccaccaccgaataccgcttcaacacccgcaaa
taa

DBGET integrated database retrieval system