KEGG   Hymenobacter swuensis: Hsw_2855Help
Entry
Hsw_2855          CDS       T03055                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hsw  Hymenobacter swuensis
Pathway
hsw00473  D-Alanine metabolism
hsw00550  Peptidoglycan biosynthesis
hsw01100  Metabolic pathways
hsw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hsw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Hsw_2855
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Hsw_2855
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Hsw_2855
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hsw01011]
    Hsw_2855
Enzymes [BR:hsw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Hsw_2855
Peptidoglycan biosynthesis and degradation proteins [BR:hsw01011]
 Precursor biosynthesis
  Amino acid ligase
   Hsw_2855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AHJ98450
UniProt: W8F9U5
LinkDB All DBs
Position
3254033..3256804
Genome map
AA seq 923 aa AA seqDB search
MKIGIFFGGPSREREISFAGGRTVYDNLDKSLFEAVPVFVDSRGNFILLNWEYIYKGTIR
DFYPPVSALPHTELPVQMYFESLGELSLEEQDRIILEVGRRVEPRELADLLDFAFLALHG
PAGEDGAVQGLLEWYGIPYSGSGILPSAFGIDKIAQKKLLKALDRPTPDFRLITAEEWDA
ADPQATLEYLVRELGLPLVFKAPRQGSSIGISILREADVAKFATAVERSLFRKTVTQTEW
QALSEQQKTVWLQQLVDIRDGIGLPVVLADSSELLAVGASLNDANSQQPTANSQHLIYQP
EELLRALDTHLATTEAVRLTSMEGETQVLVESFVQGREFSCIVVEDAAGQPLALPPTEIV
KGEEMFDYRSKYLPGLSRKITPIDLPEADIQRIREACEEMFRTFGFQVYARLDGFIGPDG
KLFLNDPNTTSGMLPASFFFHQAAEIGLNPSQFLTFLIRTSLAARRRGGLRPVKLAGLLA
QLDAAVAARASEERTRTKVAVIMGGYSSERHISVESGRNIYEKLSSSVKYEPVPVFLTGS
SQEFRLYVLPINVMLKDNADDIREKVEYMEAGHALHPILERIRREAQGITSTFAGQPTAQ
PRRVSFEELAGMVDEVFIALHGRPGEDGALQRELERFGLPYNGSGVESSSITINKFETNK
RLREAGLRVAEHRMAARLEWDADAESFYRSLETQFPYPFIAKPADDGCSSAVKKIKNRAE
LEAFTRLIFRSQEDLMPADATTLSLGFKEEFPQKEAFLVETLIDRDGAAHFLEVTGGLLT
HWDENGQLKIEVFEASEALATGEVLSLEEKFLAGEGQNITPARYATDLMERQRVSEEVKQ
ELRRVAEILHIQGYARIDAFVRVRQNGAVEVIIIEVNSLPGMTPATCIFHQTALAGYTPY
DFIDRILEFGKQRTEKQIPTTHG
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggcatcttcttcggtggcccgtcgcgcgaacgggaaatcagcttcgcgggc
ggccgcaccgtgtacgataatctggataagtccctatttgaggccgtgcccgtgtttgtg
gacagccggggcaatttcatcctgctgaactgggagtacatctacaaaggtaccatccgc
gacttttacccgcccgtatcggcgctgccgcacacggagctgccggttcagatgtacttc
gagagcctgggcgagctgagcctggaagagcaggaccgcatcattttggaagtgggccgc
cgcgtggagccccgggagctggccgacctcctcgatttcgccttcctggccctgcacggg
cccgccggcgaggacggggccgttcagggcctgctggagtggtacggcattccgtactcg
ggctccggcatcctgccctcggccttcggtatcgacaagattgcccagaagaaactgctg
aaagcattggaccggcccacgccagatttccgcctcatcacggccgaggaatgggacgcg
gccgatccgcaggccactctggagtatctggtacgtgagctgggtctgccactggtattc
aaagccccgcgtcaaggcagcagcatcggcattagtattttgcgcgaagccgacgtagcg
aagtttgctaccgccgtggaacgtagcctgttccgcaaaacagtgacgcaaacggagtgg
caggcactatcggagcagcagaaaaccgtgtggctccagcagctggtggatattcgggat
gggattgggctgccggttgttttagctgatagctcagagctgttagccgttggcgcttct
ttgaatgacgctaacagccaacagccaacagctaacagccagcacctcatctaccaaccc
gaggaactgctgcgtgccctggatacgcaccttgccacgaccgaagccgtgcgcctgacc
agcatggagggcgaaactcaggtgctggtggagagcttcgtgcagggccgcgagttttcc
tgcattgtggtggaggatgccgccggtcagccgctggccctgccgcccacagagattgtg
aagggcgaggaaatgttcgactaccgctcgaaatacctgcccggcctctcccgcaaaatc
acccccatcgacctgcccgaggccgacatccagcgcatccgggaagcctgcgaggagatg
ttccgcaccttcggttttcaggtatacgctcgcttggacggctttattggccccgatggc
aagctgttcctcaacgacccgaatactacttcgggtatgctgccggcgtcgttcttcttc
caccaggcggccgaaatcgggctgaacccctcgcagttcctgacgttcctgattcgcacc
tctttggcggcgcggcgacgcggcgggctgcggccggtaaagctggcgggcctgctggcg
caactggatgcggccgtggcagcccgggcgtcggaggagcgcacgcgcaccaaagtggcc
gttattatgggcggctactcatcggagcggcacatttcggtggaaagcggccggaatatc
tatgaaaagctcagctcctctgtcaagtacgagccggtgcccgtgttcctgaccggcagc
agtcaggagttccgcctctacgtgctgcccatcaacgtgatgctcaaggacaacgccgac
gacatccgcgagaaggtggagtacatggaggccggccacgcgctgcaccccattctggag
cgcatccgccgcgaggcccagggcatcaccagcacctttgccggtcagcccacggcccag
ccgcgccgggtgagctttgaggagctggcaggcatggtggacgaggtgtttattgccctg
cacggccgccccggcgaggacggcgcgctgcaacgggagttggagagatttggcctgccc
tacaacggctcgggcgtggaaagctccagcatcaccatcaacaagttcgaaaccaacaag
cgcctgcgcgaagccggcctacgcgtggccgagcaccgcatggccgcccgcctggagtgg
gatgccgatgccgagagcttctaccgcagcctcgaaacccagttcccctacccattcatt
gccaagcccgccgacgacggctgctcctcggccgtgaagaaaatcaagaaccgggcggag
ttggaggccttcacccgcctcatcttccgcagccaggaggaccttatgcccgccgatgcc
accacgctcagcctgggctttaaggaggaattcccgcagaaggaagccttcctggtagaa
accctgattgaccgcgacggcgcggcccacttcctggaagtaaccggcggcctgctcacg
cactgggacgaaaacggccaattaaaaatagaggtgttcgaggcttccgaggcgctggcc
accggcgaggtgctgagtctggaagagaagttcttggccggcgaaggtcagaacatcacc
ccggcccgctacgccaccgacctcatggagcgccaacgcgtgtcggaggaggtgaaacag
gagcttcgccgggtggctgaaatcctgcacatccagggctacgcccgcatcgatgccttt
gtacgggtgcgccagaacggggccgtggaggtcatcatcatcgaggtgaactccctgccc
ggcatgacgcccgccacctgcatcttccaccagacggccctggccggctacacgccttac
gatttcatcgaccggattctggagttcggcaagcagcgcacggaaaagcagatacctacc
acccatggataa

DBGET integrated database retrieval system