KEGG   Hymenobacter swuensis: Hsw_4083Help
Entry
Hsw_4083          CDS       T03055                                 

Definition
(GenBank) putative glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hsw  Hymenobacter swuensis
Pathway
hsw00564  Glycerophospholipid metabolism
hsw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hsw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Hsw_4083
Enzymes [BR:hsw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Hsw_4083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 HI0933_like GIDA
Motif
Other DBs
NCBI-ProteinID: AHJ99678
UniProt: W8F3X7
LinkDB All DBs
Position
4634091..4635710
Genome map
AA seq 539 aa AA seqDB search
MRNEIKAAAFSRPALMAQLTSQPSWDLVVVGGGATGLGVALDGLSRGYKTLLVEQTDFAK
GTSSRATKLVHGGVRYLAQGDIALVREALYERGLLLKNAPHLVKNQSFVIPTYEWWSGAY
YTFGMKIYDLLSGKLSLGAAKHISKQETIRRLGNIRTEGLHGGVVYHDGQFDDARLAINL
AQTAVEMGGTLLNHCAVRGILKDAQGQVAGVKAIDSETGKSYEIKAKAVVNATGIFVDEI
LQLDKPGTQKLVRPSQGVHIVLDKSFLPGDNAIMIPKTDDGRVLFAVPWHERVILGTTDT
PLTEYSEEPKALEEEIDFILRTAGCYLAHAPKRSDALSVFAGLRPLAAPQDGSEKTREIS
RSHKILVSEAGLITITGGKWTTYRRMGQDTVDKVISLGKLPKAESKTAGLSIHGALPTTD
EDRRNHLYVYGSDQLALLELIKQQPALGAKLDDTLEFVKAEVVWAARYEMARTVEDVLAR
RVRVLFLDAEAAIRMAPAVAALLAQELGHDHAWQQAQVTGFAQVAQNYLLEAKSTLQAV
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaacgaaattaaagctgccgccttctcccgccccgctctcatggcccagttgacc
agccagcccagctgggacctggttgtggtgggtggcggagcaacgggtctgggcgtggcc
ctcgacggccttagtcggggctacaagacactgttggttgagcaaaccgattttgccaag
ggcacgagcagccgcgctaccaaactggtccacggcggggtgcgctacttggcccagggc
gacattgccctggtgcgggaagccctatacgagcgtggtctgctactgaagaacgcgccg
cacctagttaaaaaccagtcgtttgttattcctacttacgagtggtggagcggggcgtac
tacaccttcggcatgaaaatatatgacctactgtcgggcaaactcagcctgggagcggcc
aagcacatcagcaagcaggaaacgattcggcggctaggcaacatcaggacggagggtctg
cacggcggcgtagtgtaccatgatggacagttcgatgatgcgcgcctggcaatcaacctg
gcccaaacggccgtagaaatgggcggcacgctgctcaaccactgcgcggtgcgcggcatt
ctgaaagatgcacagggacaggtagccggggtgaaagccatagacagcgagacggggaaa
tcctatgaaatcaaggcgaaagccgttgtaaatgccaccggcatttttgtggacgagatt
ctgcaactggataaacccggcacccagaagctggtgcgtcccagccagggcgtccacatc
gtactcgataagtcgtttctgccgggcgacaatgccatcatgattccgaagacggatgac
gggcgtgtgctttttgccgtgccgtggcacgagcgggttatcctgggcaccaccgacacg
cccctcacagagtacagcgaggaacccaaagccctggaagaggaaatcgacttcatcctg
cgcacggccggctgctacctcgcccacgcccccaaacgcagcgacgcactgagcgtattt
gcgggcctgcggccactggccgcgccgcaggacggctccgagaaaaccagggaaatttca
cgcagccacaagattctggtgtctgaggccgggcttattaccatcacgggcggcaaatgg
accacctaccgccgcatgggccaggatacggtagataaggttatcagcctgggaaaacta
ccgaaagcggagagcaaaacggccggtttgtccatccacggtgcgctgcctaccaccgat
gaggaccgccgcaaccacctttacgtgtatggtagcgaccagctggctttgctcgaactg
ataaagcagcaacctgctttgggcgcaaagctggatgacacccttgaatttgtgaaggcc
gaagtggtgtgggctgcccgctacgaaatggcccgcaccgtggaagacgtgctggcccgc
cgcgtacgggtgctgtttctggatgccgaagccgccattcgcatggctcccgcagtggcg
gcgctgctggcccaggagctgggccacgaccacgcctggcagcaggcgcaggtgactggc
tttgcacaggtggcccagaactacctgctggaagccaagtccacgctgcaagcagtgtag

DBGET integrated database retrieval system