KEGG   Herbaspirillum seropedicae Z67: ACP92_05420Help
Entry
ACP92_05420       CDS       T04519                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
hsz  Herbaspirillum seropedicae Z67
Pathway
hsz00250  Alanine, aspartate and glutamate metabolism
hsz00410  beta-Alanine metabolism
hsz00640  Propanoate metabolism
hsz00650  Butanoate metabolism
hsz01100  Metabolic pathways
hsz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hsz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ACP92_05420
   00650 Butanoate metabolism
    ACP92_05420
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACP92_05420
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ACP92_05420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsz01007]
    ACP92_05420
Enzymes [BR:hsz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ACP92_05420
Amino acid related enzymes [BR:hsz01007]
 Aminotransferase (transaminase)
  Class III
   ACP92_05420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AKN64710
LinkDB All DBs
Position
complement(1196199..1197479)
Genome map
AA seq 426 aa AA seqDB search
MTSKANNQELQQRKNAATPRGVGVMCDFYAERAANAELWDVEGRRFIDFAAGIAVLNTGH
RHPKLLDAMRAQMDKFTHTAYQIVPYASYVELAERINRLTPGNYPKKTAFFSTGAEAVEN
AIKIARAHTGRPGVIAFAGGFHGRTMMGMALTGKVAPYKLGFGPFPGDVFHAPYPSALHG
ITSEDALEAVKGLFKSDIEAKRVAAIILEPVQGEGGFYAAPADFMRGLRALCDEHGILLI
ADEVQSGYGRTGKLFAMEHYDVLPDLMTMAKSLAGGMPLSAVNGRAEIMDAPAPGGLGGT
YAGNPLAIASALAVLDVMEEEQLVTRGQRLGDKLQEHLKELRSSVPQIAEVRGVGAMVAV
EFADPATGKPDAEYTKKVQQHALNNGLLLLTCGSYGNVIRFLFPLTIPDTVMDEALGILA
KAIRLA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaaggccaacaaccaagagctgcaacaacgaaagaacgccgctaccccgcgc
ggcgtgggcgtgatgtgcgacttctacgccgagcgcgcagccaatgccgagttgtgggat
gtggagggccgccgcttcatcgacttcgctgccggcatcgccgttctcaataccggccat
cgtcatcccaagctgctcgacgccatgcgcgcgcagatggacaagttcacccacacggcc
taccagatcgtgccctacgccagctacgtggaactggccgagcgcatcaaccgcctcacg
ccgggcaactatccgaagaagaccgccttcttctccaccggcgccgaagcggtggaaaac
gccatcaagatcgcccgcgcccacacgggccgtccgggcgtgatcgcctttgccggcggc
ttccatggccgcaccatgatgggcatggcgctcaccggcaaggtcgcgccctacaagctg
ggtttcggccccttccccggtgacgtcttccatgccccctaccccagcgcgctgcacggc
atcaccagcgaagatgcgctggaagccgtcaagggcctcttcaagagcgacatcgaagcc
aagcgcgtcgcggccatcatcctggaaccggtgcagggcgaaggcggcttctacgccgcc
ccggccgacttcatgcgcggcctgcgcgccctctgcgacgaacacggcatcctgctgatc
gccgacgaagtgcagtccggctatggccgtaccggcaagttgtttgcgatggaacattac
gatgtcctgcccgacctgatgaccatggccaagagcctggcgggcggcatgccgctgtcg
gcggtcaatggccgcgccgagatcatggatgcgccggcccctggcggcctgggcggcacc
tacgcgggcaacccgctggccatcgcctcggcgctggcggtgctggacgtgatggaagaa
gaacagctggtgacgcgtggccagcgcctgggcgacaagctgcaggagcacctgaaggaa
ctgcgttcatccgtgccgcagatcgccgaagtgcgtggcgtgggcgcgatggtggcggtg
gagtttgccgatccggccaccggcaagcccgatgccgagtacaccaagaaggtccagcag
catgcgctcaacaacggcttgctgctgctgacctgcggcagctacggtaacgtgatccgc
ttcttgttcccgctgacgattcccgataccgtcatggacgaagcgctgggcatcctggcc
aaggctatccggctggcctga

DBGET integrated database retrieval system