KEGG   Herbaspirillum seropedicae Z67: ACP92_08390Help
Entry
ACP92_08390       CDS       T04519                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsz  Herbaspirillum seropedicae Z67
Pathway
hsz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hsz00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ACP92_08390
Enzymes [BR:hsz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ACP92_08390
Transporters [BR:hsz02000]
 Other Transporters
  Pores ion channels [TC:1]
   ACP92_08390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AKN65250
LinkDB All DBs
Position
1913391..1914062
Genome map
AA seq 223 aa AA seqDB search
MITVHHLNNSRSQRVLWLLEELGLDYEIKFYQRDPKTMLAPPELLKVHPLGKSPVITDGE
LTVAESGNIIEYLLERYGAHSGLLPASGTPERLRYRYWLHFAEGSAMPWLVMQLIFAKMP
KAVPTLIRPIARMLAEGMRSRVVAPQQERQLRFMEDELGQQGWFAGAQFSGADIQMSFPV
EALRARGGLDGRYPNLLKYLEAIHARPAYQRALEKGGPYELLR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgtgcatcacctgaacaactcccgctcccagcgcgtgctgtggctgctggaa
gagctggggctggactacgagatcaagttctaccagcgcgaccccaagaccatgctggcc
ccgccggagctgctgaaggtgcatccgctgggcaagtcgccggtcatcaccgatggcgag
ctgacggtggccgagtccggcaacatcatcgaatacctgctggaacgctacggcgcccac
agcggcctcctgcccgcgtccgggacgccagagcgcctgcgttaccgctactggctgcac
ttcgccgagggatcggcgatgccttggctggtgatgcaactgatcttcgccaagatgccc
aaggcggtgccgacgctgatccgcccgatcgccaggatgctggccgaaggcatgcgcagc
cgcgtggtggcgccgcagcaagagcgccagttacgcttcatggaggacgagctgggccag
cagggctggtttgccggggcgcagttcagcggggccgacatccagatgagtttcccggtg
gaagccctgcgcgcccgtggcggcctggatggacgttatcccaacctgctcaagtacctc
gaggccatccatgcccgtcccgcctaccagcgggcgctggaaaagggcggtccctacgaa
ttgctgcgctga

DBGET integrated database retrieval system