KEGG   Herbaspirillum seropedicae Z67: ACP92_09450Help
Entry
ACP92_09450       CDS       T04519                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
hsz  Herbaspirillum seropedicae Z67
Pathway
hsz00010  Glycolysis / Gluconeogenesis
hsz00620  Pyruvate metabolism
hsz01100  Metabolic pathways
hsz01110  Biosynthesis of secondary metabolites
hsz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hsz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACP92_09450
   00620 Pyruvate metabolism
    ACP92_09450
Enzymes [BR:hsz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     ACP92_09450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA LuxC
Motif
Other DBs
NCBI-ProteinID: AKN65440
UniProt: A2RPR1
LinkDB All DBs
Position
2152438..2153958
Genome map
AA seq 506 aa AA seqDB search
MNLADISKLGVRDPFKQRYDNFIGGKFVPPVKGEYFENISPVIGRAFCEVARSSAEDVEL
ALDAAHAAKKSWGKTSPTERANMLLKIADRMEANLELLATAETLDNGKPIRETMAADIPL
AIDHFRYFAAAVRTQEGSICPIDNDTYAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNCVVLKPAEQTPASIMVLIELIADLIPPGVVNIVQGFGVEAGKPLASNKRIAKIAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVLDKDDDFFDKALEGFAMFALNQGEV
CTCPSRVLVQESIYERFIERALKRVAAIKQGNPLDKSTMIGAQASQEQLEKILSYIDIGK
QEGAKVLAGGGREELGGDLASGYYVKPTVFQGNNKMRIFQEEIFGPVVSVTTFKDEEEAL
AIANDTLYGLGAGLWTRDGTRAFRMGREIQAGRVWTNCYHLYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSPKALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaacctggcagacatcagcaaactcggcgtacgcgaccccttcaagcaacgttacgac
aatttcatcggtggcaaattcgtgccgccggtcaagggtgaatacttcgagaacatcagc
ccggtgatcggacgcgccttctgtgaagtggcccgctccagcgccgaagacgtggagctg
gcgctggacgccgcccacgcagccaagaagagctggggcaagacctcccccaccgagcgc
gccaatatgctgttgaagatcgccgaccgcatggaagccaacctggagctgctggccact
gccgaaaccctggacaacggcaagcccatccgcgagaccatggccgccgacatcccgctg
gccatcgaccacttccgctatttcgccgctgccgtgcgcacccaggaaggcagcatctgc
cccatcgacaatgacacctacgcctaccacttccatgagcctctgggcgtggtcggccag
atcatcccctggaacttccccatcctgatggcggtgtggaaactggccccggcgctggcc
gccggcaattgcgtggtgttaaagcccgccgagcagaccccggcctccatcatggtgctg
atcgaactgatcgccgacctgatcccgccgggcgtggtcaacatcgtgcagggctttggc
gtggaagccggcaagccgctggcctccaacaagcgtatcgccaagatcgccttcactggc
gagaccaccactggccgcctgatcatgcaatacgcttcgcagaacctgatcccggtgacg
ctggagctgggcggcaagtcgcccaatatcttcttcgccgacgtgctggacaaggatgac
gacttcttcgacaaggccctggaaggctttgccatgttcgcgctgaaccagggcgaggtc
tgcacctgcccctcgcgcgtgctggtgcaggaatcgatctacgagcgcttcatcgagcgc
gccttgaagcgcgtggcggccatcaagcagggcaatccgctggacaagagcaccatgatc
ggcgcgcaggcctcgcaggaacagctggaaaagatcctgtcctacatcgacatcggcaag
caggaaggcgccaaggtgctggccggcggcgggcgcgaagaactgggcggcgacctggcc
tcgggctactacgtcaagccgaccgtgttccagggcaataacaagatgcgcatcttccag
gaagaaatctttggcccggtggtctcggtgaccaccttcaaggatgaagaagaagcgctg
gccattgccaatgacacgctgtacggcctgggcgcgggcctgtggacccgggatggcacg
cgcgccttccgcatggggcgtgagatccaggctggccgtgtctggaccaactgctatcac
ctctatccggcgcatgcggccttcggcggctacaagcaatccggcatcggccgcgaaaac
cacaagatgatgctggaccactaccagcagaccaagaacctgctggtcagctacagcccg
aaggcgctgggcttcttctga

DBGET integrated database retrieval system