KEGG   Herbaspirillum seropedicae Z67: ACP92_14435Help
Entry
ACP92_14435       CDS       T04519                                 

Definition
(GenBank) membrane protein
  KO
K11003  hemolysin D
Organism
hsz  Herbaspirillum seropedicae Z67
Pathway
hsz03070  Bacterial secretion system
Module
hsz_M00325  alpha-Hemolysin/cyclolysin transport system
Brite
KEGG Orthology (KO) [BR:hsz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ACP92_14435
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsz02000]
    ACP92_14435
   02044 Secretion system [BR:hsz02044]
    ACP92_14435
Transporters [BR:hsz02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   ACP92_14435
Secretion system [BR:hsz02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter [MD:M00325]
   ACP92_14435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_3 HlyD HlyD_D23 Biotin_lipoyl_2 Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: AKN66307
LinkDB All DBs
Position
complement(3273055..3274398)
Genome map
AA seq 447 aa AA seqDB search
MSLRHRWQAWTDLWRRYLRVFGHAWRQRGHYRSDFFNKDEAEFLPAALSLQEAPDSRSLR
WTARLLVGMVIFALLWSLLGRIDIVVSANGKVIPSARTKTIASVDVSAVRAILVSEGQLV
KAGEVLIELDSSSSDAERDKAADAVAQARLQAARAQAMMEAIQNLRTPELAQVPGVAQAQ
WEAVRSQLVAQYQDFRARLGRLDDEISRYGAALKLATQRASDYQTLVADHTVSRHAWLEK
EQARVDLQGQLDDARNQRATLVAQTRKDAHDSRIEADKTIEASQQDQRRADEHSKLLKLV
APVTGTVQQLTVHTIGGVVPAAQPLMQIVPQDSQIEVEAMLENKDVGFVEIGQAAEVKID
AFDYTKYGTLPARVVHISRDAIQDEKKGLLYSARIVLDQSSLIVDGRKVQLSAGMAANVE
IKTGNRRVIEYALSPLIRHQKEALHER
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcgtcatcgttggcaagcctggacggatctgtggcggcgctacctgcgcgtg
tttggtcatgcctggagacagcgcggccactatcgcagcgatttcttcaacaaggacgaa
gccgaattcctgccggcggcgctgtccctgcaggaagctccggactcgcgcagcctgcgc
tggaccgcgcggctcttggtggggatggtgatctttgcgctgctctggtcgctgctgggg
cgcatcgatatcgtggtcagcgccaatggcaaggtgatcccctcggcgcgcaccaagacc
attgcctcggtggatgtgtcagcggtgcgcgccatcctggtcagcgaagggcagttggtc
aaggccggagaggtgctcatcgaactcgactccagcagcagcgacgccgagcgcgacaag
gctgccgacgcggtggcccaggcgcgtctgcaggccgcgcgggcgcaggccatgatggag
gccatccagaacctgcgtacgcccgagctggcgcaggtgccgggcgtggcgcaggcccaa
tgggaagcggtgcgcagccaactggtggcgcagtaccaggatttccgcgcccgccttgga
cggctcgatgacgagatcagccgctatggcgctgccttgaaactggcgacccagcgtgcc
agcgactaccagacgctggtggccgaccacaccgtgtcgcgccatgcctggctggagaag
gagcaggccagggtggacctgcaaggccagctcgacgacgcccgcaaccagcgcgccacc
ctggtggcgcagacccgcaaggatgcccacgacagccgcatcgaggctgacaagaccatc
gaggcatcgcaacaggaccagcgccgcgccgacgagcacagcaagctgctcaagctggtc
gcgccggtcacgggcaccgtgcagcaactcaccgtgcataccatcggcggggtcgtgccg
gcggcgcagccgctcatgcagatcgtgccgcaggatagccagatcgaagtcgaggccatg
ctggagaacaaggacgtgggctttgtcgagatcggtcaggcggccgaggtcaagatcgac
gccttcgactacaccaagtacggcaccctcccggccagggtggtccacatctcgcgcgac
gccatccaggatgaaaagaaaggcctgctctactcggcccgcatcgtgctggaccagagc
agcctcatcgtcgatgggcgcaaggtgcagctctcggccggcatggccgccaatgtggaa
atcaagacgggcaatcgccgggtcatcgaatatgcgctctcgccgctgatccggcaccag
aaggaggctctgcatgagcgatga

DBGET integrated database retrieval system