KEGG   Herbaspirillum seropedicae Z67: ACP92_15795Help
Entry
ACP92_15795       CDS       T04519                                 

Definition
(GenBank) 6-phosphogluconolactonase
  KO
K07404  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
hsz  Herbaspirillum seropedicae Z67
Pathway
hsz00030  Pentose phosphate pathway
hsz01100  Metabolic pathways
hsz01110  Biosynthesis of secondary metabolites
hsz01120  Microbial metabolism in diverse environments
hsz01130  Biosynthesis of antibiotics
hsz01200  Carbon metabolism
Module
hsz_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:hsz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ACP92_15795
Enzymes [BR:hsz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     ACP92_15795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactonase SGL DUF5122
Motif
Other DBs
NCBI-ProteinID: AKN68284
LinkDB All DBs
Position
complement(3607356..3608414)
Genome map
AA seq 352 aa AA seqDB search
MIATSALSLATSHAGAATIAYVSHADSQDIYVLRLNNDGSVNLIDKVDTGSTVMPLAISP
DRKYLYASLRREPYAVASYAIDPASGKLKALSKAPLADNMANIATDRSGRYLLAASYFGN
KISVNAIGSDGAVQTPPLAVIPTGKNAHSVQVDPANAFVFASNLGSDVILQYRFDPASGA
VTPNTPPSVASKAGAGPRHFVFSPDQRFLYCANELDATVSTYAYDRQAGTLTLLGSDSAL
PEGFQSSEQLAAADLHLTPDGRFLYATERTSNTLTGYRVDRASGKLTRILNIPTETQPRA
FNIDPQGRYLLAVGQKAGLTSYAIDAASGTLTPLFRYTLGRNPNWVEIIDLP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
ttgattgccacctccgccctcagcctggcgaccagccatgccggtgccgccaccatcgcc
tacgtttcccatgccgacagccaggacatctacgtcctgcgactcaacaacgatggcagc
gtcaacctgatcgacaaggtcgataccggcagcaccgtgatgccgctggccatcagccct
gaccgcaaatacctctatgcgtccctgcgccgcgagccgtatgcggtggccagctatgcc
atcgatcccgccagcggcaagctcaaggcgttgtccaaggcgccgctggccgacaacatg
gccaatatcgccaccgaccgcagcggtcgctacctgctggcggcgtcctacttcggcaac
aagatctcggtcaatgccatcggcagcgacggcgccgtgcagacgccgccgctggcggtg
attcccactggcaagaacgcccactcggtgcaggtcgatcctgccaatgccttcgtcttt
gccagcaacctgggcagtgacgtgatcctgcaataccgtttcgatcctgcttctggcgcg
gtcacgcccaatacgccgccctcggtggcgagcaaggccggggccggtccgcgtcacttc
gtgttctcgcccgaccagcgtttcctctattgcgccaatgaactcgacgccaccgtcagc
acctatgcctatgaccgccaggctggcacgctgaccctgctgggcagtgactcggccttg
ccggaaggcttccagagcagcgaacaactggccgctgccgacctgcacctgaccccggat
ggtcgcttcctctatgccaccgagcgcacctccaacaccctcaccggctaccgcgtggac
cgcgccagcggcaagctgacccgcatcctcaacatccccaccgaaacccagccacgggct
ttcaacatcgacccgcaagggcgctacctgctcgccgtcgggcaaaaggctggcctgacc
agttatgccatcgatgccgccagcgggacgctgacgcccttgttccgctataccctgggc
cgcaatccgaattgggtcgagatcatcgacctgccctga

DBGET integrated database retrieval system