KEGG   Haloarcula taiwanensis: BVU17_11995Help
Entry
BVU17_11995       CDS       T05292                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hta  Haloarcula taiwanensis
Pathway
hta00564  Glycerophospholipid metabolism
hta01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BVU17_11995
Enzymes [BR:hta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BVU17_11995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_3 FAD_binding_2 Pyr_redox_2 FAD_oxidored Pyr_redox HI0933_like NAD_binding_8 NAD_binding_7 Lycopene_cycl Thi4 Pyr_redox_3 GIDA 3HCDH_N ApbA PALP
Motif
Other DBs
NCBI-ProteinID: AUG48209
UniProt: A0A2H5A0E8
LinkDB All DBs
Position
I:2362938..2364158
Genome map
AA seq 406 aa AA seqDB search
MAIETDVLVVGGGATGAGVARDLALRGVDVTLVERNGLTSGTSGRSHGLLHSGARYAEAD
RVGAEECIAENRILKEIAGACIRDTGGLFVQLAADDPDYFEAKRAACAEVGIPVETLDAD
AARERVPDLAPDVERAFEVPDAVIYPSRLVAANAADARDHGATIHPHAPVEDVLVENGHV
VGVQVGGTADDSIEADYVVNATGAWAGEFAAMAGLNVEMQPTRGVMVSVEYDALGPVLNR
CRDPDDGDIVVPHENEAVLGTTSVPVRDPDEYETEQWEIEESIEECAAMLPPVADAPEVR
TWWGVRPLYAPDEAERGRGISRGFFLLDHADDGVDNMASIVGGKLTTYRQMAEATADRVC
DNLGVDAACRTADQTLPGVDDPKQLDALVAEFDGQGPTDQDVVGST
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgagacggatgtccttgtcgtcggtggtggcgcgaccggcgctggcgtcgct
cgtgacctcgcactccgtggcgtcgacgtgacgctcgtcgagcgcaacgggctgacaagc
ggtacctccgggcgctcgcacggactgttacacagcggagcccgctacgccgaggccgac
cgggtcggtgccgaggagtgcatcgccgaaaaccggatactcaaggagatcgccggagcc
tgcatccgtgacaccggcgggttgttcgtccagctcgccgcggacgaccccgactacttc
gaggccaagcgggcggcctgtgcggaggtcggtatccccgtcgagacgctggacgccgat
gcggcccgcgagcgagtgcctgacctcgcgcccgacgttgagcgcgcgttcgaagtcccg
gacgccgtcatttatccgtcgcggctcgtcgccgcaaacgccgcagacgcgcgcgaccac
ggtgcaacgatacacccacacgcacccgtcgaagacgtcctcgtcgagaacgggcacgtg
gtcggcgtgcaggtcggcgggacagccgacgacagtatcgaggccgactacgtcgtcaat
gcgaccggggcctgggctggcgagtttgccgcgatggccggcctcaacgtcgagatgcaa
ccgacgcgaggggtgatggtctcagtcgagtacgacgccctcgggccggtactcaaccgc
tgtcgggaccccgacgacggcgacatcgtcgtgccacacgagaacgaggccgtcctcgga
acgacgagcgtgcccgtccgcgacccggacgagtacgagacggagcagtgggagatcgag
gagagcatcgaggagtgtgcggcgatgctgccgccagttgcagacgcacccgaggtccgg
acctggtggggcgtccgaccgctgtacgcgccagacgaggcggagcgcggccgcggtatc
tcgcggggcttcttcctgctcgaccatgccgacgacggcgtcgacaacatggcgagtatc
gtcggcggcaagctgaccacctatcggcagatggccgaggcgaccgccgaccgcgtctgt
gacaacctcggcgttgacgctgcctgtcggactgcggaccagacgctcccgggcgtcgac
gacccgaaacaactggacgcgctcgtggccgagttcgacggtcagggcccgactgaccaa
gacgtggtcgggtcgacgtaa

DBGET integrated database retrieval system