KEGG   Haloarcula taiwanensis: BVU17_13295Help
Entry
BVU17_13295       CDS       T05292                                 

Definition
(GenBank) RNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
hta  Haloarcula taiwanensis
Brite
KEGG Orthology (KO) [BR:hta00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BVU17_13295
Enzymes [BR:hta01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BVU17_13295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AUG48453
UniProt: A0A2H5A151
LinkDB All DBs
Position
I:2614272..2615384
Genome map
AA seq 370 aa AA seqDB search
MSRDWGSLFDVDADPADLLEHFDTEWFRGQRYRHLSDERHGIERGTALVDDVVVRGYPSM
PRALVLEPAVRETFEGPVAIEEKLNGYNVRVARIDGDLLAFTRSGFVCPYTTRKVEALLD
AEAFFDDHPEHMLCGELVGPENPYTDHEYSEVEEVGFYVFGIRHRESGTPMGVERRLDRC
ETYGLESVDHYGTYTPAAAVDVARERIDDLNARDREGVVLKSTDGKTALKYTTSAIHRAD
LEHAFELPFDYGRDFVFTRVIREAFQAVERGESPATIRERAQELGEAILQPAVETIRAVD
RGDPVGETHTVRGDPKTIADLLSYFRDQGLELHIERDETDGNQRVVTFTKVAQSTRDKTR
YYLEGGTIDE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagagactgggggtcgctgttcgacgtcgacgccgaccccgcggacctgctggaa
cacttcgacaccgagtggttccgcggccagcggtaccgacacctcagcgacgagcgccac
ggcatcgagcgcgggacggcgctcgtcgacgacgtggtcgtccggggctacccgtcgatg
ccgcgcgcgctcgtcctcgaaccggcggttcgggagaccttcgagggacccgtcgccatc
gaggagaaactcaacggctacaacgtcagggtcgcccgaatcgacggggacctactcgcg
ttcacccggagcgggttcgtctgtccctacaccacgcggaaggtcgaggcgctgctcgac
gccgaggcgttcttcgacgaccaccccgagcacatgctgtgtggcgaactcgtcgggccg
gagaacccctacaccgaccacgagtacagcgaggtcgaggaggtcgggttctacgtgttt
gggatccgccaccgcgagagcgggacgccgatgggcgtcgaacggcgcctcgaccggtgt
gagacctacggcctcgaaagcgtcgaccactacgggacctacaccccggcagcggccgtc
gacgtcgcccgcgaacggatcgatgatctgaacgctcgcgaccgggaaggcgttgtcttg
aaatcgacggacgggaagacggcgctgaagtacacgacgagcgcgatccatcgggccgat
cttgaacacgcgttcgaactaccattcgactacgggcgagacttcgttttcacccgcgtc
atacgggaggctttccaggccgtcgagcgcggcgagtcgccggcaacgattcgcgagcgg
gcacaggagttgggtgaagccattcttcagcctgcagtcgaaacaatacgggcggtagac
agaggtgacccggtcggcgaaacacacaccgttcgtggcgacccgaaaaccatcgccgac
ctgctgtcgtacttccgcgatcagggcctggaactccatatcgagcgtgacgagacggat
ggcaaccagcgggttgtcacgtttaccaaggtcgcccagtcgacgcgtgacaagacgcga
tactacctagagggtgggaccatcgacgagtga

DBGET integrated database retrieval system