KEGG   Hydrogenobacter thermophilus: Hydth_0305Help
Entry
Hydth_0305        CDS       T02106                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
hte  Hydrogenobacter thermophilus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo
Motif
Other DBs
NCBI-ProteinID: ADO44709
UniProt: D3DG22
LinkDB All DBs
Position
complement(312561..313376)
Genome map
AA seq 271 aa AA seqDB search
MDSTEEKNIILGTYQILSLLGRGTFGEVYKVRVLRGRYRGKMMALKVARNAEVLPYLWRE
VQTLLLFNHPHIISLQSYLYKKDRGELYVLYELMDVGDLKDYVVSNGKLSEENALKVLLH
VAKGLEFLHSRGYIHGDVKPENIFGKRVLRDVVWKLGDFGLVRIRGSESIIDVKGTAGYI
APEVFRGEIHRSSDIFSLGCVLHFMLTGRDPFECEDRKEKLKRNKEGACTIEDGLSERIK
TLLHIMLSKDPTKRFRTAKELIEYMIRERLA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggatagtacagaagaaaagaacatcatcttaggcacttatcagatcctttccctcctt
ggtagaggtacctttggagaggtttataaagttagagtgctaaggggcagatacagaggc
aagatgatggctctgaaagtggcaagaaatgcggaagttttgccttacctttggagagaa
gttcagacgcttcttttgttcaaccaccctcacataatatccttgcagagctacctttac
aaaaaagatagaggagagctttatgtgctttacgagcttatggatgtgggtgaccttaag
gactatgtagtaagcaacggcaaactttcggaagagaacgctttaaaggtacttctgcat
gtggcaaaaggacttgagttcttgcacagcaggggatatatacacggggatgtaaagcct
gaaaacatctttggcaaaagggtgctcagggatgtggtctggaagctcggagactttgga
cttgtaaggataagaggtagcgaaagcatcatagatgtaaagggcactgcaggatacata
gcacctgaggtgttcaggggtgagatacacagaagcagtgatatattctctctgggttgt
gtccttcactttatgctgacaggaagggacccttttgagtgtgaagacagaaaagaaaaa
ctcaaaagaaacaaggaaggcgcatgcactatagaagatggtctgtctgagcgcataaaa
actcttctccatatcatgctgagcaaggatcctacaaaaaggttcaggacagcaaaggaa
cttattgagtacatgataagggagaggttagcatga

DBGET integrated database retrieval system